CA2625891A1 - Inhibition of pax2 by defb1 induction as a therapy for cancer - Google Patents
Inhibition of pax2 by defb1 induction as a therapy for cancer Download PDFInfo
- Publication number
- CA2625891A1 CA2625891A1 CA002625891A CA2625891A CA2625891A1 CA 2625891 A1 CA2625891 A1 CA 2625891A1 CA 002625891 A CA002625891 A CA 002625891A CA 2625891 A CA2625891 A CA 2625891A CA 2625891 A1 CA2625891 A1 CA 2625891A1
- Authority
- CA
- Canada
- Prior art keywords
- pax2
- gene
- cells
- expression
- defb1
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 206010028980 Neoplasm Diseases 0.000 title claims abstract description 97
- 201000011510 cancer Diseases 0.000 title claims abstract description 51
- 101100518992 Mus musculus Pax2 gene Proteins 0.000 title claims description 50
- 230000006698 induction Effects 0.000 title description 22
- 230000005764 inhibitory process Effects 0.000 title description 21
- 238000002560 therapeutic procedure Methods 0.000 title description 4
- 230000014509 gene expression Effects 0.000 claims abstract description 180
- 238000000034 method Methods 0.000 claims abstract description 168
- 206010060862 Prostate cancer Diseases 0.000 claims abstract description 54
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims abstract description 54
- 230000027455 binding Effects 0.000 claims abstract description 52
- 101000613577 Homo sapiens Paired box protein Pax-2 Proteins 0.000 claims abstract description 42
- 108091034117 Oligonucleotide Proteins 0.000 claims abstract description 36
- 230000004568 DNA-binding Effects 0.000 claims abstract description 30
- 230000001965 increasing effect Effects 0.000 claims abstract description 25
- 102100040852 Paired box protein Pax-2 Human genes 0.000 claims abstract description 22
- 230000002401 inhibitory effect Effects 0.000 claims abstract description 14
- 230000000295 complement effect Effects 0.000 claims abstract description 9
- 230000000903 blocking effect Effects 0.000 claims abstract description 6
- 150000007523 nucleic acids Chemical class 0.000 claims description 105
- 101000952040 Homo sapiens Beta-defensin 1 Proteins 0.000 claims description 103
- 102000039446 nucleic acids Human genes 0.000 claims description 101
- 108020004707 nucleic acids Proteins 0.000 claims description 101
- 102100037437 Beta-defensin 1 Human genes 0.000 claims description 100
- 125000003729 nucleotide group Chemical group 0.000 claims description 76
- 239000002773 nucleotide Substances 0.000 claims description 62
- 230000002441 reversible effect Effects 0.000 claims description 10
- 108091026890 Coding region Proteins 0.000 claims description 9
- 108020004459 Small interfering RNA Proteins 0.000 claims 2
- 210000004027 cell Anatomy 0.000 description 287
- 102000016907 PAX2 Transcription Factor Human genes 0.000 description 286
- 108010028842 PAX2 Transcription Factor Proteins 0.000 description 286
- 108090000623 proteins and genes Proteins 0.000 description 256
- 102000004169 proteins and genes Human genes 0.000 description 100
- 101100498892 Aedes aegypti DEFB gene Proteins 0.000 description 96
- 235000018102 proteins Nutrition 0.000 description 94
- 230000000694 effects Effects 0.000 description 67
- 239000000203 mixture Substances 0.000 description 66
- 108020004414 DNA Proteins 0.000 description 59
- 230000035772 mutation Effects 0.000 description 55
- 241000282414 Homo sapiens Species 0.000 description 53
- 101100518991 Homo sapiens PAX2 gene Proteins 0.000 description 53
- 101150085593 PAX2 gene Proteins 0.000 description 53
- 239000013598 vector Substances 0.000 description 48
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 45
- 238000011282 treatment Methods 0.000 description 43
- 108090000765 processed proteins & peptides Proteins 0.000 description 37
- 210000001519 tissue Anatomy 0.000 description 37
- 108020004999 messenger RNA Proteins 0.000 description 34
- 238000009396 hybridization Methods 0.000 description 32
- 238000006243 chemical reaction Methods 0.000 description 31
- 239000003112 inhibitor Substances 0.000 description 30
- 201000003221 Renal coloboma syndrome Diseases 0.000 description 29
- 230000003993 interaction Effects 0.000 description 29
- 102000011727 Caspases Human genes 0.000 description 28
- 108010076667 Caspases Proteins 0.000 description 28
- 238000004458 analytical method Methods 0.000 description 28
- 239000000047 product Substances 0.000 description 28
- 238000012552 review Methods 0.000 description 28
- 238000013518 transcription Methods 0.000 description 28
- 230000035897 transcription Effects 0.000 description 28
- 230000004048 modification Effects 0.000 description 26
- 238000012986 modification Methods 0.000 description 26
- 108091023040 Transcription factor Proteins 0.000 description 25
- 235000001014 amino acid Nutrition 0.000 description 24
- 230000015572 biosynthetic process Effects 0.000 description 24
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 24
- 239000003623 enhancer Substances 0.000 description 24
- 229940024606 amino acid Drugs 0.000 description 23
- 238000011161 development Methods 0.000 description 22
- 230000018109 developmental process Effects 0.000 description 22
- 201000010099 disease Diseases 0.000 description 22
- 150000001413 amino acids Chemical class 0.000 description 21
- 230000023603 positive regulation of transcription initiation, DNA-dependent Effects 0.000 description 21
- -1 uracil-5-yl Chemical group 0.000 description 21
- 230000003612 virological effect Effects 0.000 description 21
- 201000001355 Duane-radial ray syndrome Diseases 0.000 description 20
- 108010029485 Protein Isoforms Proteins 0.000 description 20
- 102000001708 Protein Isoforms Human genes 0.000 description 20
- 102000040945 Transcription factor Human genes 0.000 description 20
- 150000001875 compounds Chemical class 0.000 description 20
- 230000006870 function Effects 0.000 description 20
- 235000000346 sugar Nutrition 0.000 description 20
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 19
- 239000013612 plasmid Substances 0.000 description 19
- 239000002502 liposome Substances 0.000 description 18
- 102000004196 processed proteins & peptides Human genes 0.000 description 18
- 239000003446 ligand Substances 0.000 description 17
- 239000012528 membrane Substances 0.000 description 17
- 102000005962 receptors Human genes 0.000 description 17
- 108020003175 receptors Proteins 0.000 description 17
- 241001465754 Metazoa Species 0.000 description 16
- 230000000692 anti-sense effect Effects 0.000 description 16
- 238000005516 engineering process Methods 0.000 description 16
- 238000010186 staining Methods 0.000 description 16
- 206010064571 Gene mutation Diseases 0.000 description 15
- 108060003199 Glucagon Proteins 0.000 description 15
- 241000700605 Viruses Species 0.000 description 15
- 230000003833 cell viability Effects 0.000 description 15
- 230000001404 mediated effect Effects 0.000 description 15
- 238000006467 substitution reaction Methods 0.000 description 15
- 108090000994 Catalytic RNA Proteins 0.000 description 14
- 102000053642 Catalytic RNA Human genes 0.000 description 14
- 108700020796 Oncogene Proteins 0.000 description 14
- 102000001004 Secreted frizzled-related protein 2 Human genes 0.000 description 14
- 108050007987 Secreted frizzled-related protein 2 Proteins 0.000 description 14
- 230000001640 apoptogenic effect Effects 0.000 description 14
- 230000006907 apoptotic process Effects 0.000 description 14
- 201000010819 coloboma of optic nerve Diseases 0.000 description 14
- 239000002299 complementary DNA Substances 0.000 description 14
- 230000000670 limiting effect Effects 0.000 description 14
- 239000013642 negative control Substances 0.000 description 14
- 210000002307 prostate Anatomy 0.000 description 14
- 230000001177 retroviral effect Effects 0.000 description 14
- 108091092562 ribozyme Proteins 0.000 description 14
- 230000008685 targeting Effects 0.000 description 14
- 239000013603 viral vector Substances 0.000 description 14
- 206010058314 Dysplasia Diseases 0.000 description 13
- 238000012228 RNA interference-mediated gene silencing Methods 0.000 description 13
- 230000010261 cell growth Effects 0.000 description 13
- 230000009368 gene silencing by RNA Effects 0.000 description 13
- 238000001727 in vivo Methods 0.000 description 13
- 239000000463 material Substances 0.000 description 13
- 230000004083 survival effect Effects 0.000 description 13
- 208000008839 Kidney Neoplasms Diseases 0.000 description 12
- 238000004364 calculation method Methods 0.000 description 12
- 230000030833 cell death Effects 0.000 description 12
- ZMMJGEGLRURXTF-UHFFFAOYSA-N ethidium bromide Chemical compound [Br-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 ZMMJGEGLRURXTF-UHFFFAOYSA-N 0.000 description 12
- 229960005542 ethidium bromide Drugs 0.000 description 12
- 241000701161 unidentified adenovirus Species 0.000 description 12
- DPKHZNPWBDQZCN-UHFFFAOYSA-N acridine orange free base Chemical compound C1=CC(N(C)C)=CC2=NC3=CC(N(C)C)=CC=C3C=C21 DPKHZNPWBDQZCN-UHFFFAOYSA-N 0.000 description 11
- DZBUGLKDJFMEHC-UHFFFAOYSA-N benzoquinolinylidene Natural products C1=CC=CC2=CC3=CC=CC=C3N=C21 DZBUGLKDJFMEHC-UHFFFAOYSA-N 0.000 description 11
- 238000001514 detection method Methods 0.000 description 11
- 230000010354 integration Effects 0.000 description 11
- 210000003734 kidney Anatomy 0.000 description 11
- 210000001328 optic nerve Anatomy 0.000 description 11
- 208000034528 Acro-renal-ocular syndrome Diseases 0.000 description 10
- 108091023037 Aptamer Proteins 0.000 description 10
- 201000000913 Duane retraction syndrome Diseases 0.000 description 10
- 102100038885 Histone acetyltransferase p300 Human genes 0.000 description 10
- 101000882390 Homo sapiens Histone acetyltransferase p300 Proteins 0.000 description 10
- 208000007766 Kaposi sarcoma Diseases 0.000 description 10
- 101710125418 Major capsid protein Proteins 0.000 description 10
- 101000978776 Mus musculus Neurogenic locus notch homolog protein 1 Proteins 0.000 description 10
- 102100021133 Nuclear protein 1 Human genes 0.000 description 10
- 101710170054 Nuclear protein 1 Proteins 0.000 description 10
- 208000031785 Okihiro syndrome Diseases 0.000 description 10
- 208000001647 Renal Insufficiency Diseases 0.000 description 10
- 238000004422 calculation algorithm Methods 0.000 description 10
- 239000003814 drug Substances 0.000 description 10
- 230000012010 growth Effects 0.000 description 10
- 238000000338 in vitro Methods 0.000 description 10
- 201000006370 kidney failure Diseases 0.000 description 10
- 229920002521 macromolecule Polymers 0.000 description 10
- 230000007246 mechanism Effects 0.000 description 10
- 210000003733 optic disk Anatomy 0.000 description 10
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 10
- 230000002384 proinvasive effect Effects 0.000 description 10
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 10
- 201000005966 renal hypoplasia Diseases 0.000 description 10
- 238000012216 screening Methods 0.000 description 10
- 239000000243 solution Substances 0.000 description 10
- 229910052717 sulfur Inorganic materials 0.000 description 10
- 108010077544 Chromatin Proteins 0.000 description 9
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 9
- 208000008383 Wilms tumor Diseases 0.000 description 9
- 230000005856 abnormality Effects 0.000 description 9
- 210000003483 chromatin Anatomy 0.000 description 9
- 238000012217 deletion Methods 0.000 description 9
- 230000037430 deletion Effects 0.000 description 9
- 238000002474 experimental method Methods 0.000 description 9
- 238000003780 insertion Methods 0.000 description 9
- 230000037431 insertion Effects 0.000 description 9
- 210000004940 nucleus Anatomy 0.000 description 9
- 238000011160 research Methods 0.000 description 9
- 239000000523 sample Substances 0.000 description 9
- 150000003384 small molecules Chemical class 0.000 description 9
- 238000013519 translation Methods 0.000 description 9
- 241001430294 unidentified retrovirus Species 0.000 description 9
- 101100297347 Caenorhabditis elegans pgl-3 gene Proteins 0.000 description 8
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 8
- 101000721661 Homo sapiens Cellular tumor antigen p53 Proteins 0.000 description 8
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 8
- 241001529936 Murinae Species 0.000 description 8
- 241000699670 Mus sp. Species 0.000 description 8
- 108700026244 Open Reading Frames Proteins 0.000 description 8
- 230000004913 activation Effects 0.000 description 8
- 125000000217 alkyl group Chemical group 0.000 description 8
- 210000000349 chromosome Anatomy 0.000 description 8
- 230000001419 dependent effect Effects 0.000 description 8
- 229940079593 drug Drugs 0.000 description 8
- 239000003937 drug carrier Substances 0.000 description 8
- 239000012634 fragment Substances 0.000 description 8
- 230000003211 malignant effect Effects 0.000 description 8
- 239000003550 marker Substances 0.000 description 8
- 238000004806 packaging method and process Methods 0.000 description 8
- 230000010076 replication Effects 0.000 description 8
- 150000003839 salts Chemical class 0.000 description 8
- 239000000758 substrate Substances 0.000 description 8
- 238000003786 synthesis reaction Methods 0.000 description 8
- 230000002103 transcriptional effect Effects 0.000 description 8
- 108091035707 Consensus sequence Proteins 0.000 description 7
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 7
- 238000002487 chromatin immunoprecipitation Methods 0.000 description 7
- 238000010367 cloning Methods 0.000 description 7
- 230000007423 decrease Effects 0.000 description 7
- 238000000370 laser capture micro-dissection Methods 0.000 description 7
- 238000007431 microscopic evaluation Methods 0.000 description 7
- 230000000861 pro-apoptotic effect Effects 0.000 description 7
- 230000001225 therapeutic effect Effects 0.000 description 7
- 238000005406 washing Methods 0.000 description 7
- KDCGOANMDULRCW-UHFFFAOYSA-N 7H-purine Chemical compound N1=CNC2=NC=NC2=C1 KDCGOANMDULRCW-UHFFFAOYSA-N 0.000 description 6
- 108090000672 Annexin A5 Proteins 0.000 description 6
- 241000282692 Catarrhini Species 0.000 description 6
- 241000251556 Chordata Species 0.000 description 6
- 241000199632 Craniata <brachiopoda> Species 0.000 description 6
- 102000004190 Enzymes Human genes 0.000 description 6
- 108090000790 Enzymes Proteins 0.000 description 6
- 241001272171 Euarchontoglires Species 0.000 description 6
- 241000235808 Euteleostomi Species 0.000 description 6
- 241000289695 Eutheria Species 0.000 description 6
- 108700005087 Homeobox Genes Proteins 0.000 description 6
- 102000009331 Homeodomain Proteins Human genes 0.000 description 6
- 108010048671 Homeodomain Proteins Proteins 0.000 description 6
- 241000282418 Hominidae Species 0.000 description 6
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 6
- 102100025169 Max-binding protein MNT Human genes 0.000 description 6
- 101100462885 Mus musculus Pax9 gene Proteins 0.000 description 6
- 102000007999 Nuclear Proteins Human genes 0.000 description 6
- 108010089610 Nuclear Proteins Proteins 0.000 description 6
- 241000288906 Primates Species 0.000 description 6
- 208000006265 Renal cell carcinoma Diseases 0.000 description 6
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 6
- 108700025716 Tumor Suppressor Genes Proteins 0.000 description 6
- 102000044209 Tumor Suppressor Genes Human genes 0.000 description 6
- 210000004899 c-terminal region Anatomy 0.000 description 6
- 239000000969 carrier Substances 0.000 description 6
- 230000015556 catabolic process Effects 0.000 description 6
- 210000000170 cell membrane Anatomy 0.000 description 6
- 230000014107 chromosome localization Effects 0.000 description 6
- 230000002596 correlated effect Effects 0.000 description 6
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 6
- 238000006731 degradation reaction Methods 0.000 description 6
- 238000003745 diagnosis Methods 0.000 description 6
- 238000010790 dilution Methods 0.000 description 6
- 239000012895 dilution Substances 0.000 description 6
- 230000002255 enzymatic effect Effects 0.000 description 6
- 229940088598 enzyme Drugs 0.000 description 6
- 230000005284 excitation Effects 0.000 description 6
- 238000002866 fluorescence resonance energy transfer Methods 0.000 description 6
- 238000003197 gene knockdown Methods 0.000 description 6
- 230000002068 genetic effect Effects 0.000 description 6
- 230000036039 immunity Effects 0.000 description 6
- 230000001939 inductive effect Effects 0.000 description 6
- 230000004807 localization Effects 0.000 description 6
- 230000026731 phosphorylation Effects 0.000 description 6
- 238000006366 phosphorylation reaction Methods 0.000 description 6
- 229920001184 polypeptide Polymers 0.000 description 6
- 208000021046 prostate intraepithelial neoplasia Diseases 0.000 description 6
- 238000010839 reverse transcription Methods 0.000 description 6
- 239000011780 sodium chloride Substances 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- 239000000725 suspension Substances 0.000 description 6
- 108091006107 transcriptional repressors Proteins 0.000 description 6
- 238000001890 transfection Methods 0.000 description 6
- 238000011830 transgenic mouse model Methods 0.000 description 6
- PJYYBCXMCWDUAZ-JJJZTNILSA-N 2,3,14,20,22-pentahydroxy-(2β,3β,5β,22R)-Cholest-7-en-6-one Chemical compound C1[C@@H](O)[C@@H](O)C[C@]2(C)[C@@H](CC[C@@]3([C@@H]([C@@](C)(O)[C@H](O)CCC(C)C)CC[C@]33O)C)C3=CC(=O)[C@@H]21 PJYYBCXMCWDUAZ-JJJZTNILSA-N 0.000 description 5
- 102000004121 Annexin A5 Human genes 0.000 description 5
- 102000010637 Aquaporins Human genes 0.000 description 5
- 108010063290 Aquaporins Proteins 0.000 description 5
- 102000001421 BRCT domains Human genes 0.000 description 5
- 108050009608 BRCT domains Proteins 0.000 description 5
- 208000030808 Clear cell renal carcinoma Diseases 0.000 description 5
- 241000255601 Drosophila melanogaster Species 0.000 description 5
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 5
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 5
- 101000979338 Homo sapiens Nuclear factor NF-kappa-B p100 subunit Proteins 0.000 description 5
- 101001098523 Homo sapiens PAX-interacting protein 1 Proteins 0.000 description 5
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 5
- 108010055717 JNK Mitogen-Activated Protein Kinases Proteins 0.000 description 5
- 102000005711 Keratin-7 Human genes 0.000 description 5
- 108010070507 Keratin-7 Proteins 0.000 description 5
- 238000000134 MTT assay Methods 0.000 description 5
- 231100000002 MTT assay Toxicity 0.000 description 5
- 241000124008 Mammalia Species 0.000 description 5
- 102000048850 Neoplasm Genes Human genes 0.000 description 5
- 108700019961 Neoplasm Genes Proteins 0.000 description 5
- 102100023059 Nuclear factor NF-kappa-B p100 subunit Human genes 0.000 description 5
- 108091028043 Nucleic acid sequence Proteins 0.000 description 5
- 102000013901 Nucleoside diphosphate kinase Human genes 0.000 description 5
- 102100037141 PAX-interacting protein 1 Human genes 0.000 description 5
- 238000010222 PCR analysis Methods 0.000 description 5
- 102000018964 Paired Box Transcription Factors Human genes 0.000 description 5
- 108010026706 Paired Box Transcription Factors Proteins 0.000 description 5
- 108091093037 Peptide nucleic acid Proteins 0.000 description 5
- PJYYBCXMCWDUAZ-YKDQUOQBSA-N Ponasterone A Natural products O=C1[C@H]2[C@@](C)([C@@H]3C([C@@]4(O)[C@@](C)([C@H]([C@@](O)([C@@H](O)CCC(C)C)C)CC4)CC3)=C1)C[C@H](O)[C@H](O)C2 PJYYBCXMCWDUAZ-YKDQUOQBSA-N 0.000 description 5
- 102000009572 RNA Polymerase II Human genes 0.000 description 5
- 108010009460 RNA Polymerase II Proteins 0.000 description 5
- 238000002123 RNA extraction Methods 0.000 description 5
- 206010038486 Renal neoplasms Diseases 0.000 description 5
- 108020004566 Transfer RNA Proteins 0.000 description 5
- 101710100179 UMP-CMP kinase Proteins 0.000 description 5
- 101710119674 UMP-CMP kinase 2, mitochondrial Proteins 0.000 description 5
- 206010047370 Vesicoureteric reflux Diseases 0.000 description 5
- 230000003321 amplification Effects 0.000 description 5
- 238000000137 annealing Methods 0.000 description 5
- 230000028600 axonogenesis Effects 0.000 description 5
- 230000001364 causal effect Effects 0.000 description 5
- 230000024245 cell differentiation Effects 0.000 description 5
- 206010073251 clear cell renal cell carcinoma Diseases 0.000 description 5
- 230000003247 decreasing effect Effects 0.000 description 5
- 238000013461 design Methods 0.000 description 5
- 238000004520 electroporation Methods 0.000 description 5
- 230000013020 embryo development Effects 0.000 description 5
- 230000008175 fetal development Effects 0.000 description 5
- 230000001605 fetal effect Effects 0.000 description 5
- 238000009472 formulation Methods 0.000 description 5
- 238000012252 genetic analysis Methods 0.000 description 5
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 5
- 102000049943 human PAX2 Human genes 0.000 description 5
- 238000001114 immunoprecipitation Methods 0.000 description 5
- 210000004153 islets of langerhan Anatomy 0.000 description 5
- 208000017169 kidney disease Diseases 0.000 description 5
- 238000013507 mapping Methods 0.000 description 5
- 239000002609 medium Substances 0.000 description 5
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 5
- 125000000325 methylidene group Chemical group [H]C([H])=* 0.000 description 5
- 238000002493 microarray Methods 0.000 description 5
- 201000011330 nonpapillary renal cell carcinoma Diseases 0.000 description 5
- 238000003199 nucleic acid amplification method Methods 0.000 description 5
- 230000005305 organ development Effects 0.000 description 5
- 230000037361 pathway Effects 0.000 description 5
- 230000008488 polyadenylation Effects 0.000 description 5
- 238000012545 processing Methods 0.000 description 5
- XJMOSONTPMZWPB-UHFFFAOYSA-M propidium iodide Chemical compound [I-].[I-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CCC[N+](C)(CC)CC)=C1C1=CC=CC=C1 XJMOSONTPMZWPB-UHFFFAOYSA-M 0.000 description 5
- 229950010131 puromycin Drugs 0.000 description 5
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 5
- 238000009555 renal ultrasonography Methods 0.000 description 5
- 102200140005 rs104894170 Human genes 0.000 description 5
- 230000001629 suppression Effects 0.000 description 5
- 238000012546 transfer Methods 0.000 description 5
- 230000005945 translocation Effects 0.000 description 5
- 238000011144 upstream manufacturing Methods 0.000 description 5
- 201000008618 vesicoureteral reflux Diseases 0.000 description 5
- 208000031355 vesicoureteral reflux 1 Diseases 0.000 description 5
- 230000016776 visual perception Effects 0.000 description 5
- 238000001262 western blot Methods 0.000 description 5
- 101150084750 1 gene Proteins 0.000 description 4
- HKIPCXRNASWFRU-UHFFFAOYSA-N 1,3-difluoropropan-2-one Chemical compound FCC(=O)CF HKIPCXRNASWFRU-UHFFFAOYSA-N 0.000 description 4
- 102100027308 Apoptosis regulator BAX Human genes 0.000 description 4
- 206010004446 Benign prostatic hyperplasia Diseases 0.000 description 4
- 101000986346 Chironomus tentans High mobility group protein I Proteins 0.000 description 4
- 108020004705 Codon Proteins 0.000 description 4
- 206010009944 Colon cancer Diseases 0.000 description 4
- 150000008574 D-amino acids Chemical class 0.000 description 4
- 108010002069 Defensins Proteins 0.000 description 4
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 4
- 102100031181 Glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 4
- 101000800488 Homo sapiens T-cell leukemia homeobox protein 1 Proteins 0.000 description 4
- 102100034343 Integrase Human genes 0.000 description 4
- 108060001084 Luciferase Proteins 0.000 description 4
- 239000005089 Luciferase Substances 0.000 description 4
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 4
- 239000004472 Lysine Substances 0.000 description 4
- 241000699660 Mus musculus Species 0.000 description 4
- 108091005461 Nucleic proteins Proteins 0.000 description 4
- 229910019142 PO4 Inorganic materials 0.000 description 4
- 208000004403 Prostatic Hyperplasia Diseases 0.000 description 4
- 102000000574 RNA-Induced Silencing Complex Human genes 0.000 description 4
- 108010016790 RNA-Induced Silencing Complex Proteins 0.000 description 4
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 4
- 108091027981 Response element Proteins 0.000 description 4
- 108700009124 Transcription Initiation Site Proteins 0.000 description 4
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 4
- 239000002253 acid Substances 0.000 description 4
- 125000003275 alpha amino acid group Chemical group 0.000 description 4
- 125000000539 amino acid group Chemical group 0.000 description 4
- 238000013459 approach Methods 0.000 description 4
- 230000033228 biological regulation Effects 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 238000003776 cleavage reaction Methods 0.000 description 4
- 238000010276 construction Methods 0.000 description 4
- 230000034994 death Effects 0.000 description 4
- 238000009510 drug design Methods 0.000 description 4
- 230000004927 fusion Effects 0.000 description 4
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 4
- 239000001963 growth medium Substances 0.000 description 4
- 102000044958 human TLX1 Human genes 0.000 description 4
- 239000007928 intraperitoneal injection Substances 0.000 description 4
- 150000002632 lipids Chemical group 0.000 description 4
- 230000035699 permeability Effects 0.000 description 4
- 239000008194 pharmaceutical composition Substances 0.000 description 4
- 238000002135 phase contrast microscopy Methods 0.000 description 4
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 4
- 235000021317 phosphate Nutrition 0.000 description 4
- 239000010452 phosphate Substances 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 238000003757 reverse transcription PCR Methods 0.000 description 4
- 230000007017 scission Effects 0.000 description 4
- 238000012163 sequencing technique Methods 0.000 description 4
- 230000004614 tumor growth Effects 0.000 description 4
- 241001529453 unidentified herpesvirus Species 0.000 description 4
- 239000003981 vehicle Substances 0.000 description 4
- BZTDTCNHAFUJOG-UHFFFAOYSA-N 6-carboxyfluorescein Chemical compound C12=CC=C(O)C=C2OC2=CC(O)=CC=C2C11OC(=O)C2=CC=C(C(=O)O)C=C21 BZTDTCNHAFUJOG-UHFFFAOYSA-N 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- 102100032187 Androgen receptor Human genes 0.000 description 3
- 201000009030 Carcinoma Diseases 0.000 description 3
- 241000701022 Cytomegalovirus Species 0.000 description 3
- 230000004544 DNA amplification Effects 0.000 description 3
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 3
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 3
- 102000000541 Defensins Human genes 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- 108700039887 Essential Genes Proteins 0.000 description 3
- 206010018338 Glioma Diseases 0.000 description 3
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 3
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 3
- OFOBLEOULBTSOW-UHFFFAOYSA-N Malonic acid Chemical compound OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 description 3
- 102000003729 Neprilysin Human genes 0.000 description 3
- 108090000028 Neprilysin Proteins 0.000 description 3
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 3
- 238000012408 PCR amplification Methods 0.000 description 3
- KWYUFKZDYYNOTN-UHFFFAOYSA-M Potassium hydroxide Chemical compound [OH-].[K+] KWYUFKZDYYNOTN-UHFFFAOYSA-M 0.000 description 3
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 238000011529 RT qPCR Methods 0.000 description 3
- 206010038389 Renal cancer Diseases 0.000 description 3
- 238000010818 SYBR green PCR Master Mix Methods 0.000 description 3
- 241000529895 Stercorarius Species 0.000 description 3
- 108700026226 TATA Box Proteins 0.000 description 3
- 108700019146 Transgenes Proteins 0.000 description 3
- 101100323865 Xenopus laevis arg1 gene Proteins 0.000 description 3
- IBXPAFBDJCXCDW-MHFPCNPESA-A [Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].Cc1cn([C@H]2C[C@H](O)[C@@H](COP([S-])(=O)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3CO)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c3nc(N)[nH]c4=O)n3ccc(N)nc3=O)n3cnc4c3nc(N)[nH]c4=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3ccc(N)nc3=O)n3cnc4c3nc(N)[nH]c4=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O Chemical compound [Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].Cc1cn([C@H]2C[C@H](O)[C@@H](COP([S-])(=O)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3CO)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c3nc(N)[nH]c4=O)n3ccc(N)nc3=O)n3cnc4c3nc(N)[nH]c4=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3ccc(N)nc3=O)n3cnc4c3nc(N)[nH]c4=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O IBXPAFBDJCXCDW-MHFPCNPESA-A 0.000 description 3
- 108010080146 androgen receptors Proteins 0.000 description 3
- 239000007864 aqueous solution Substances 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 239000001506 calcium phosphate Substances 0.000 description 3
- 229910000389 calcium phosphate Inorganic materials 0.000 description 3
- 235000011010 calcium phosphates Nutrition 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 125000002091 cationic group Chemical group 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 238000005119 centrifugation Methods 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 238000005094 computer simulation Methods 0.000 description 3
- 230000000875 corresponding effect Effects 0.000 description 3
- 238000004132 cross linking Methods 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 229940104302 cytosine Drugs 0.000 description 3
- 231100000135 cytotoxicity Toxicity 0.000 description 3
- 230000003013 cytotoxicity Effects 0.000 description 3
- 239000008121 dextrose Substances 0.000 description 3
- 238000010494 dissociation reaction Methods 0.000 description 3
- 230000005593 dissociations Effects 0.000 description 3
- 239000012636 effector Substances 0.000 description 3
- 239000000839 emulsion Substances 0.000 description 3
- 230000012202 endocytosis Effects 0.000 description 3
- 108700004025 env Genes Proteins 0.000 description 3
- 210000000981 epithelium Anatomy 0.000 description 3
- 210000003527 eukaryotic cell Anatomy 0.000 description 3
- 239000013604 expression vector Substances 0.000 description 3
- 239000012737 fresh medium Substances 0.000 description 3
- 108700004026 gag Genes Proteins 0.000 description 3
- 238000001415 gene therapy Methods 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- 208000015181 infectious disease Diseases 0.000 description 3
- 230000000977 initiatory effect Effects 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 230000015788 innate immune response Effects 0.000 description 3
- 230000002452 interceptive effect Effects 0.000 description 3
- 239000007927 intramuscular injection Substances 0.000 description 3
- 238000010255 intramuscular injection Methods 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 235000018977 lysine Nutrition 0.000 description 3
- 238000012423 maintenance Methods 0.000 description 3
- 201000001441 melanoma Diseases 0.000 description 3
- 239000011859 microparticle Substances 0.000 description 3
- 238000000386 microscopy Methods 0.000 description 3
- 238000000302 molecular modelling Methods 0.000 description 3
- 238000002703 mutagenesis Methods 0.000 description 3
- 231100000350 mutagenesis Toxicity 0.000 description 3
- 230000036963 noncompetitive effect Effects 0.000 description 3
- 238000011275 oncology therapy Methods 0.000 description 3
- 238000007911 parenteral administration Methods 0.000 description 3
- 239000002245 particle Substances 0.000 description 3
- 239000000825 pharmaceutical preparation Substances 0.000 description 3
- 229940127557 pharmaceutical product Drugs 0.000 description 3
- 108700004029 pol Genes Proteins 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 210000005267 prostate cell Anatomy 0.000 description 3
- 210000000064 prostate epithelial cell Anatomy 0.000 description 3
- 230000010837 receptor-mediated endocytosis Effects 0.000 description 3
- 230000009467 reduction Effects 0.000 description 3
- 230000001105 regulatory effect Effects 0.000 description 3
- 210000002345 respiratory system Anatomy 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 238000010561 standard procedure Methods 0.000 description 3
- 239000002562 thickening agent Substances 0.000 description 3
- 230000001988 toxicity Effects 0.000 description 3
- 231100000419 toxicity Toxicity 0.000 description 3
- 239000012096 transfection reagent Substances 0.000 description 3
- 230000009261 transgenic effect Effects 0.000 description 3
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 3
- 210000004881 tumor cell Anatomy 0.000 description 3
- 230000003827 upregulation Effects 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- SGKRLCUYIXIAHR-AKNGSSGZSA-N (4s,4ar,5s,5ar,6r,12ar)-4-(dimethylamino)-1,5,10,11,12a-pentahydroxy-6-methyl-3,12-dioxo-4a,5,5a,6-tetrahydro-4h-tetracene-2-carboxamide Chemical compound C1=CC=C2[C@H](C)[C@@H]([C@H](O)[C@@H]3[C@](C(O)=C(C(N)=O)C(=O)[C@H]3N(C)C)(O)C3=O)C3=C(O)C2=C1O SGKRLCUYIXIAHR-AKNGSSGZSA-N 0.000 description 2
- RQFCJASXJCIDSX-UHFFFAOYSA-N 14C-Guanosin-5'-monophosphat Natural products C1=2NC(N)=NC(=O)C=2N=CN1C1OC(COP(O)(O)=O)C(O)C1O RQFCJASXJCIDSX-UHFFFAOYSA-N 0.000 description 2
- FZWGECJQACGGTI-UHFFFAOYSA-N 2-amino-7-methyl-1,7-dihydro-6H-purin-6-one Chemical compound NC1=NC(O)=C2N(C)C=NC2=N1 FZWGECJQACGGTI-UHFFFAOYSA-N 0.000 description 2
- ASJSAQIRZKANQN-CRCLSJGQSA-N 2-deoxy-D-ribose Chemical compound OC[C@@H](O)[C@@H](O)CC=O ASJSAQIRZKANQN-CRCLSJGQSA-N 0.000 description 2
- OVONXEQGWXGFJD-UHFFFAOYSA-N 4-sulfanylidene-1h-pyrimidin-2-one Chemical compound SC=1C=CNC(=O)N=1 OVONXEQGWXGFJD-UHFFFAOYSA-N 0.000 description 2
- RYVNIFSIEDRLSJ-UHFFFAOYSA-N 5-(hydroxymethyl)cytosine Chemical compound NC=1NC(=O)N=CC=1CO RYVNIFSIEDRLSJ-UHFFFAOYSA-N 0.000 description 2
- LRSASMSXMSNRBT-UHFFFAOYSA-N 5-methylcytosine Chemical compound CC1=CNC(=O)N=C1N LRSASMSXMSNRBT-UHFFFAOYSA-N 0.000 description 2
- UJBCLAXPPIDQEE-UHFFFAOYSA-N 5-prop-1-ynyl-1h-pyrimidine-2,4-dione Chemical compound CC#CC1=CNC(=O)NC1=O UJBCLAXPPIDQEE-UHFFFAOYSA-N 0.000 description 2
- PEHVGBZKEYRQSX-UHFFFAOYSA-N 7-deaza-adenine Chemical compound NC1=NC=NC2=C1C=CN2 PEHVGBZKEYRQSX-UHFFFAOYSA-N 0.000 description 2
- HCGHYQLFMPXSDU-UHFFFAOYSA-N 7-methyladenine Chemical compound C1=NC(N)=C2N(C)C=NC2=N1 HCGHYQLFMPXSDU-UHFFFAOYSA-N 0.000 description 2
- LRFVTYWOQMYALW-UHFFFAOYSA-N 9H-xanthine Chemical compound O=C1NC(=O)NC2=C1NC=N2 LRFVTYWOQMYALW-UHFFFAOYSA-N 0.000 description 2
- 229930024421 Adenine Natural products 0.000 description 2
- 108050008874 Annexin Proteins 0.000 description 2
- 102000000412 Annexin Human genes 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- 208000005623 Carcinogenesis Diseases 0.000 description 2
- 108091006146 Channels Proteins 0.000 description 2
- 102000005853 Clathrin Human genes 0.000 description 2
- 108010019874 Clathrin Proteins 0.000 description 2
- HMFHBZSHGGEWLO-SOOFDHNKSA-N D-ribofuranose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H]1O HMFHBZSHGGEWLO-SOOFDHNKSA-N 0.000 description 2
- 230000006820 DNA synthesis Effects 0.000 description 2
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 2
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 2
- 241000702421 Dependoparvovirus Species 0.000 description 2
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 2
- 208000032612 Glial tumor Diseases 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- AEMRFAOFKBGASW-UHFFFAOYSA-N Glycolic acid Chemical compound OCC(O)=O AEMRFAOFKBGASW-UHFFFAOYSA-N 0.000 description 2
- NYHBQMYGNKIUIF-UUOKFMHZSA-N Guanosine Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O NYHBQMYGNKIUIF-UUOKFMHZSA-N 0.000 description 2
- 108020005004 Guide RNA Proteins 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000601664 Homo sapiens Paired box protein Pax-8 Proteins 0.000 description 2
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 2
- 241000725303 Human immunodeficiency virus Species 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 206010025323 Lymphomas Diseases 0.000 description 2
- 241000713869 Moloney murine leukemia virus Species 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 206010029260 Neuroblastoma Diseases 0.000 description 2
- 101710163270 Nuclease Proteins 0.000 description 2
- 102100037502 Paired box protein Pax-8 Human genes 0.000 description 2
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 2
- UQVKZNNCIHJZLS-UHFFFAOYSA-N PhIP Chemical compound C1=C2N(C)C(N)=NC2=NC=C1C1=CC=CC=C1 UQVKZNNCIHJZLS-UHFFFAOYSA-N 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- 102100039418 Plasminogen activator inhibitor 1 Human genes 0.000 description 2
- 239000004698 Polyethylene Substances 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- 241000125945 Protoparvovirus Species 0.000 description 2
- CZPWVGJYEJSRLH-UHFFFAOYSA-N Pyrimidine Chemical compound C1=CN=CN=C1 CZPWVGJYEJSRLH-UHFFFAOYSA-N 0.000 description 2
- LCTONWCANYUPML-UHFFFAOYSA-N Pyruvic acid Chemical compound CC(=O)C(O)=O LCTONWCANYUPML-UHFFFAOYSA-N 0.000 description 2
- 108020005091 Replication Origin Proteins 0.000 description 2
- PYMYPHUHKUWMLA-LMVFSUKVSA-N Ribose Natural products OC[C@@H](O)[C@@H](O)[C@@H](O)C=O PYMYPHUHKUWMLA-LMVFSUKVSA-N 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 206010039491 Sarcoma Diseases 0.000 description 2
- 241000700584 Simplexvirus Species 0.000 description 2
- 238000000692 Student's t-test Methods 0.000 description 2
- 208000037065 Subacute sclerosing leukoencephalitis Diseases 0.000 description 2
- 206010042297 Subacute sclerosing panencephalitis Diseases 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- 239000004098 Tetracycline Substances 0.000 description 2
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Natural products O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- 241000700618 Vaccinia virus Species 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- 230000035508 accumulation Effects 0.000 description 2
- 238000009825 accumulation Methods 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 229960000643 adenine Drugs 0.000 description 2
- 230000002411 adverse Effects 0.000 description 2
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 2
- 125000003342 alkenyl group Chemical group 0.000 description 2
- 125000000304 alkynyl group Chemical group 0.000 description 2
- HMFHBZSHGGEWLO-UHFFFAOYSA-N alpha-D-Furanose-Ribose Natural products OCC1OC(O)C(O)C1O HMFHBZSHGGEWLO-UHFFFAOYSA-N 0.000 description 2
- 150000001408 amides Chemical group 0.000 description 2
- 150000001412 amines Chemical group 0.000 description 2
- 239000004599 antimicrobial Substances 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 125000004429 atom Chemical group 0.000 description 2
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 2
- 239000012148 binding buffer Substances 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 230000036952 cancer formation Effects 0.000 description 2
- 230000000711 cancerogenic effect Effects 0.000 description 2
- 150000001720 carbohydrates Chemical group 0.000 description 2
- 231100000504 carcinogenesis Toxicity 0.000 description 2
- 231100000315 carcinogenic Toxicity 0.000 description 2
- 230000003197 catalytic effect Effects 0.000 description 2
- 230000006721 cell death pathway Effects 0.000 description 2
- 230000022534 cell killing Effects 0.000 description 2
- 230000004663 cell proliferation Effects 0.000 description 2
- 239000006285 cell suspension Substances 0.000 description 2
- 230000007248 cellular mechanism Effects 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical group C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 229930193282 clathrin Natural products 0.000 description 2
- 210000002806 clathrin-coated vesicle Anatomy 0.000 description 2
- 208000029742 colonic neoplasm Diseases 0.000 description 2
- 230000002860 competitive effect Effects 0.000 description 2
- 230000001010 compromised effect Effects 0.000 description 2
- 230000001276 controlling effect Effects 0.000 description 2
- 238000012926 crystallographic analysis Methods 0.000 description 2
- 125000000753 cycloalkyl group Chemical group 0.000 description 2
- 210000000805 cytoplasm Anatomy 0.000 description 2
- 231100000433 cytotoxic Toxicity 0.000 description 2
- 230000001472 cytotoxic effect Effects 0.000 description 2
- 238000002784 cytotoxicity assay Methods 0.000 description 2
- 231100000263 cytotoxicity test Toxicity 0.000 description 2
- 238000004925 denaturation Methods 0.000 description 2
- 230000036425 denaturation Effects 0.000 description 2
- 238000009792 diffusion process Methods 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- XBDQKXXYIPTUBI-UHFFFAOYSA-N dimethylselenoniopropionate Natural products CCC(O)=O XBDQKXXYIPTUBI-UHFFFAOYSA-N 0.000 description 2
- 208000035475 disorder Diseases 0.000 description 2
- 230000003828 downregulation Effects 0.000 description 2
- 230000002900 effect on cell Effects 0.000 description 2
- 210000002889 endothelial cell Anatomy 0.000 description 2
- 238000000684 flow cytometry Methods 0.000 description 2
- 230000030279 gene silencing Effects 0.000 description 2
- 238000003205 genotyping method Methods 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- 230000002518 glial effect Effects 0.000 description 2
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 description 2
- 125000000404 glutamine group Chemical group N[C@@H](CCC(N)=O)C(=O)* 0.000 description 2
- 238000006206 glycosylation reaction Methods 0.000 description 2
- RQFCJASXJCIDSX-UUOKFMHZSA-N guanosine 5'-monophosphate Chemical compound C1=2NC(N)=NC(=O)C=2N=CN1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@H]1O RQFCJASXJCIDSX-UUOKFMHZSA-N 0.000 description 2
- 125000001475 halogen functional group Chemical group 0.000 description 2
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 2
- 238000002744 homologous recombination Methods 0.000 description 2
- 230000006801 homologous recombination Effects 0.000 description 2
- 102000046975 human DEFB1 Human genes 0.000 description 2
- 125000001165 hydrophobic group Chemical group 0.000 description 2
- 206010020718 hyperplasia Diseases 0.000 description 2
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 2
- 238000007689 inspection Methods 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 230000006662 intracellular pathway Effects 0.000 description 2
- 238000012804 iterative process Methods 0.000 description 2
- 201000010982 kidney cancer Diseases 0.000 description 2
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 2
- 208000032839 leukemia Diseases 0.000 description 2
- 238000001638 lipofection Methods 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 208000020816 lung neoplasm Diseases 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- 210000003712 lysosome Anatomy 0.000 description 2
- 230000001868 lysosomic effect Effects 0.000 description 2
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- BDAGIHXWWSANSR-UHFFFAOYSA-N methanoic acid Natural products OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 2
- 239000003094 microcapsule Substances 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 238000000329 molecular dynamics simulation Methods 0.000 description 2
- 230000009456 molecular mechanism Effects 0.000 description 2
- 210000000214 mouth Anatomy 0.000 description 2
- 229930014626 natural product Natural products 0.000 description 2
- 239000012457 nonaqueous media Substances 0.000 description 2
- 239000002777 nucleoside Substances 0.000 description 2
- 238000011580 nude mouse model Methods 0.000 description 2
- 235000021231 nutrient uptake Nutrition 0.000 description 2
- 229960000435 oblimersen Drugs 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 235000019198 oils Nutrition 0.000 description 2
- 231100000590 oncogenic Toxicity 0.000 description 2
- 230000002246 oncogenic effect Effects 0.000 description 2
- 201000002528 pancreatic cancer Diseases 0.000 description 2
- 208000008443 pancreatic carcinoma Diseases 0.000 description 2
- 230000001575 pathological effect Effects 0.000 description 2
- 230000007170 pathology Effects 0.000 description 2
- VLTRZXGMWDSKGL-UHFFFAOYSA-N perchloric acid Chemical compound OCl(=O)(=O)=O VLTRZXGMWDSKGL-UHFFFAOYSA-N 0.000 description 2
- 238000002823 phage display Methods 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 239000013641 positive control Substances 0.000 description 2
- SCVFZCLFOSHCOH-UHFFFAOYSA-M potassium acetate Chemical compound [K+].CC([O-])=O SCVFZCLFOSHCOH-UHFFFAOYSA-M 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 208000023958 prostate neoplasm Diseases 0.000 description 2
- 201000007094 prostatitis Diseases 0.000 description 2
- 150000003212 purines Chemical class 0.000 description 2
- 238000011472 radical prostatectomy Methods 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 230000037425 regulation of transcription Effects 0.000 description 2
- 230000003362 replicative effect Effects 0.000 description 2
- 230000022932 ruffle assembly Effects 0.000 description 2
- 238000010187 selection method Methods 0.000 description 2
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 2
- 230000006807 siRNA silencing Effects 0.000 description 2
- 230000011664 signaling Effects 0.000 description 2
- 239000004055 small Interfering RNA Substances 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 238000005507 spraying Methods 0.000 description 2
- 206010041823 squamous cell carcinoma Diseases 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 125000001424 substituent group Chemical group 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 238000010189 synthetic method Methods 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 229960002180 tetracycline Drugs 0.000 description 2
- 229930101283 tetracycline Natural products 0.000 description 2
- 235000019364 tetracycline Nutrition 0.000 description 2
- 150000003522 tetracyclines Chemical class 0.000 description 2
- ZMZDMBWJUHKJPS-UHFFFAOYSA-N thiocyanic acid Chemical compound SC#N ZMZDMBWJUHKJPS-UHFFFAOYSA-N 0.000 description 2
- RYYWUUFWQRZTIU-UHFFFAOYSA-K thiophosphate Chemical compound [O-]P([O-])([O-])=S RYYWUUFWQRZTIU-UHFFFAOYSA-K 0.000 description 2
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- 239000003053 toxin Substances 0.000 description 2
- 231100000765 toxin Toxicity 0.000 description 2
- 108700012359 toxins Proteins 0.000 description 2
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 2
- 238000010361 transduction Methods 0.000 description 2
- 230000026683 transduction Effects 0.000 description 2
- 230000032258 transport Effects 0.000 description 2
- 238000010396 two-hybrid screening Methods 0.000 description 2
- 229940035893 uracil Drugs 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 238000012800 visualization Methods 0.000 description 2
- 239000011534 wash buffer Substances 0.000 description 2
- 230000003442 weekly effect Effects 0.000 description 2
- OPCHFPHZPIURNA-MFERNQICSA-N (2s)-2,5-bis(3-aminopropylamino)-n-[2-(dioctadecylamino)acetyl]pentanamide Chemical compound CCCCCCCCCCCCCCCCCCN(CC(=O)NC(=O)[C@H](CCCNCCCN)NCCCN)CCCCCCCCCCCCCCCCCC OPCHFPHZPIURNA-MFERNQICSA-N 0.000 description 1
- BHQCQFFYRZLCQQ-UHFFFAOYSA-N (3alpha,5alpha,7alpha,12alpha)-3,7,12-trihydroxy-cholan-24-oic acid Natural products OC1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)C(O)C2 BHQCQFFYRZLCQQ-UHFFFAOYSA-N 0.000 description 1
- QGVQZRDQPDLHHV-DPAQBDIFSA-N (3s,8s,9s,10r,13r,14s,17r)-10,13-dimethyl-17-[(2r)-6-methylheptan-2-yl]-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1h-cyclopenta[a]phenanthrene-3-thiol Chemical compound C1C=C2C[C@@H](S)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 QGVQZRDQPDLHHV-DPAQBDIFSA-N 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- FYADHXFMURLYQI-UHFFFAOYSA-N 1,2,4-triazine Chemical class C1=CN=NC=N1 FYADHXFMURLYQI-UHFFFAOYSA-N 0.000 description 1
- 125000003287 1H-imidazol-4-ylmethyl group Chemical group [H]N1C([H])=NC(C([H])([H])[*])=C1[H] 0.000 description 1
- IAIGWBZFHIEWJI-UHFFFAOYSA-N 1h-1,4-benzodiazepine-2,5-dione Chemical class N1C(=O)C=NC(=O)C2=CC=CC=C21 IAIGWBZFHIEWJI-UHFFFAOYSA-N 0.000 description 1
- UHUHBFMZVCOEOV-UHFFFAOYSA-N 1h-imidazo[4,5-c]pyridin-4-amine Chemical compound NC1=NC=CC2=C1N=CN2 UHUHBFMZVCOEOV-UHFFFAOYSA-N 0.000 description 1
- DHNXIUKHARJIHD-UHFFFAOYSA-N 1h-imidazole;1h-pyrrolo[2,3-f]quinoline Chemical compound C1=CNC=N1.N1=CC=CC2=C(NC=C3)C3=CC=C21 DHNXIUKHARJIHD-UHFFFAOYSA-N 0.000 description 1
- PSHUCDDCHMPXTI-UHFFFAOYSA-N 1h-imidazole;thieno[2,3-f]quinoline Chemical class C1=CNC=N1.N1=CC=CC2=C(SC=C3)C3=CC=C21 PSHUCDDCHMPXTI-UHFFFAOYSA-N 0.000 description 1
- LDGWQMRUWMSZIU-LQDDAWAPSA-M 2,3-bis[(z)-octadec-9-enoxy]propyl-trimethylazanium;chloride Chemical compound [Cl-].CCCCCCCC\C=C/CCCCCCCCOCC(C[N+](C)(C)C)OCCCCCCCC\C=C/CCCCCCCC LDGWQMRUWMSZIU-LQDDAWAPSA-M 0.000 description 1
- QSHACTSJHMKXTE-UHFFFAOYSA-N 2-(2-aminopropyl)-7h-purin-6-amine Chemical compound CC(N)CC1=NC(N)=C2NC=NC2=N1 QSHACTSJHMKXTE-UHFFFAOYSA-N 0.000 description 1
- PIINGYXNCHTJTF-UHFFFAOYSA-N 2-(2-azaniumylethylamino)acetate Chemical compound NCCNCC(O)=O PIINGYXNCHTJTF-UHFFFAOYSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- KMEMIMRPZGDOMG-UHFFFAOYSA-N 2-cyanoethoxyphosphonamidous acid Chemical compound NP(O)OCCC#N KMEMIMRPZGDOMG-UHFFFAOYSA-N 0.000 description 1
- HAOOXLOWFGXQEQ-UHFFFAOYSA-N 2-methylidene-3h-1,3-thiazole Chemical class C=C1NC=CS1 HAOOXLOWFGXQEQ-UHFFFAOYSA-N 0.000 description 1
- UGWULZWUXSCWPX-UHFFFAOYSA-N 2-sulfanylideneimidazolidin-4-one Chemical compound O=C1CNC(=S)N1 UGWULZWUXSCWPX-UHFFFAOYSA-N 0.000 description 1
- LNQVTSROQXJCDD-KQYNXXCUSA-N 3'-AMP Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](OP(O)(O)=O)[C@H]1O LNQVTSROQXJCDD-KQYNXXCUSA-N 0.000 description 1
- AZKSAVLVSZKNRD-UHFFFAOYSA-M 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide Chemical compound [Br-].S1C(C)=C(C)N=C1[N+]1=NC(C=2C=CC=CC=2)=NN1C1=CC=CC=C1 AZKSAVLVSZKNRD-UHFFFAOYSA-M 0.000 description 1
- BMYNFMYTOJXKLE-UHFFFAOYSA-N 3-azaniumyl-2-hydroxypropanoate Chemical compound NCC(O)C(O)=O BMYNFMYTOJXKLE-UHFFFAOYSA-N 0.000 description 1
- OSWFIVFLDKOXQC-UHFFFAOYSA-N 4-(3-methoxyphenyl)aniline Chemical compound COC1=CC=CC(C=2C=CC(N)=CC=2)=C1 OSWFIVFLDKOXQC-UHFFFAOYSA-N 0.000 description 1
- ZLAQATDNGLKIEV-UHFFFAOYSA-N 5-methyl-2-sulfanylidene-1h-pyrimidin-4-one Chemical compound CC1=CNC(=S)NC1=O ZLAQATDNGLKIEV-UHFFFAOYSA-N 0.000 description 1
- KXBCLNRMQPRVTP-UHFFFAOYSA-N 6-amino-1,5-dihydroimidazo[4,5-c]pyridin-4-one Chemical compound O=C1NC(N)=CC2=C1N=CN2 KXBCLNRMQPRVTP-UHFFFAOYSA-N 0.000 description 1
- DCPSTSVLRXOYGS-UHFFFAOYSA-N 6-amino-1h-pyrimidine-2-thione Chemical compound NC1=CC=NC(S)=N1 DCPSTSVLRXOYGS-UHFFFAOYSA-N 0.000 description 1
- QNNARSZPGNJZIX-UHFFFAOYSA-N 6-amino-5-prop-1-ynyl-1h-pyrimidin-2-one Chemical compound CC#CC1=CNC(=O)N=C1N QNNARSZPGNJZIX-UHFFFAOYSA-N 0.000 description 1
- LOSIULRWFAEMFL-UHFFFAOYSA-N 7-deazaguanine Chemical compound O=C1NC(N)=NC2=C1CC=N2 LOSIULRWFAEMFL-UHFFFAOYSA-N 0.000 description 1
- HRYKDUPGBWLLHO-UHFFFAOYSA-N 8-azaadenine Chemical compound NC1=NC=NC2=NNN=C12 HRYKDUPGBWLLHO-UHFFFAOYSA-N 0.000 description 1
- LPXQRXLUHJKZIE-UHFFFAOYSA-N 8-azaguanine Chemical compound NC1=NC(O)=C2NN=NC2=N1 LPXQRXLUHJKZIE-UHFFFAOYSA-N 0.000 description 1
- 229960005508 8-azaguanine Drugs 0.000 description 1
- MSSXOMSJDRHRMC-UHFFFAOYSA-N 9H-purine-2,6-diamine Chemical compound NC1=NC(N)=C2NC=NC2=N1 MSSXOMSJDRHRMC-UHFFFAOYSA-N 0.000 description 1
- 239000013607 AAV vector Substances 0.000 description 1
- 208000002008 AIDS-Related Lymphoma Diseases 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 208000003200 Adenoma Diseases 0.000 description 1
- IPWKGIFRRBGCJO-IMJSIDKUSA-N Ala-Ser Chemical compound C[C@H]([NH3+])C(=O)N[C@@H](CO)C([O-])=O IPWKGIFRRBGCJO-IMJSIDKUSA-N 0.000 description 1
- 102100027211 Albumin Human genes 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 108091093088 Amplicon Proteins 0.000 description 1
- 206010051999 Anogenital dysplasia Diseases 0.000 description 1
- 102000044503 Antimicrobial Peptides Human genes 0.000 description 1
- 108700042778 Antimicrobial Peptides Proteins 0.000 description 1
- 102100021569 Apoptosis regulator Bcl-2 Human genes 0.000 description 1
- 241000945470 Arcturus Species 0.000 description 1
- JQFZHHSQMKZLRU-IUCAKERBSA-N Arg-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CCCN=C(N)N JQFZHHSQMKZLRU-IUCAKERBSA-N 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 208000003950 B-cell lymphoma Diseases 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 101000981884 Brevibacillus parabrevis Valine racemase [ATP-hydrolyzing] Proteins 0.000 description 1
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 1
- 241000220450 Cajanus cajan Species 0.000 description 1
- 208000017897 Carcinoma of esophagus Diseases 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 206010008263 Cervical dysplasia Diseases 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 239000004380 Cholic acid Substances 0.000 description 1
- 241000557626 Corvus corax Species 0.000 description 1
- MIKUYHXYGGJMLM-GIMIYPNGSA-N Crotonoside Natural products C1=NC2=C(N)NC(=O)N=C2N1[C@H]1O[C@@H](CO)[C@H](O)[C@@H]1O MIKUYHXYGGJMLM-GIMIYPNGSA-N 0.000 description 1
- YXQDRIRSAHTJKM-IMJSIDKUSA-N Cys-Ser Chemical compound SC[C@H](N)C(=O)N[C@@H](CO)C(O)=O YXQDRIRSAHTJKM-IMJSIDKUSA-N 0.000 description 1
- NYHBQMYGNKIUIF-UHFFFAOYSA-N D-guanosine Natural products C1=2NC(N)=NC(=O)C=2N=CN1C1OC(CO)C(O)C1O NYHBQMYGNKIUIF-UHFFFAOYSA-N 0.000 description 1
- KDXKERNSBIXSRK-RXMQYKEDSA-N D-lysine Chemical compound NCCCC[C@@H](N)C(O)=O KDXKERNSBIXSRK-RXMQYKEDSA-N 0.000 description 1
- 230000008836 DNA modification Effects 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 241000450599 DNA viruses Species 0.000 description 1
- 102000052510 DNA-Binding Proteins Human genes 0.000 description 1
- 108700020911 DNA-Binding Proteins Proteins 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- UPEZCKBFRMILAV-JNEQICEOSA-N Ecdysone Natural products O=C1[C@H]2[C@@](C)([C@@H]3C([C@@]4(O)[C@@](C)([C@H]([C@H]([C@@H](O)CCC(O)(C)C)C)CC4)CC3)=C1)C[C@H](O)[C@H](O)C2 UPEZCKBFRMILAV-JNEQICEOSA-N 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 241000991587 Enterovirus C Species 0.000 description 1
- 108010050456 Eosinophil-Derived Neurotoxin Proteins 0.000 description 1
- 102000013888 Eosinophil-Derived Neurotoxin Human genes 0.000 description 1
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 1
- 108091029865 Exogenous DNA Proteins 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 101150086776 FAM3C gene Proteins 0.000 description 1
- 108010040476 FITC-annexin A5 Proteins 0.000 description 1
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 201000003741 Gastrointestinal carcinoma Diseases 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- DXJZITDUDUPINW-WHFBIAKZSA-N Gln-Asn Chemical compound NC(=O)CC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(O)=O DXJZITDUDUPINW-WHFBIAKZSA-N 0.000 description 1
- TWHDOEYLXXQYOZ-FXQIFTODSA-N Gln-Asn-Gln Chemical compound C(CC(=O)N)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N TWHDOEYLXXQYOZ-FXQIFTODSA-N 0.000 description 1
- FTIJVMLAGRAYMJ-MNXVOIDGSA-N Gln-Ile-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H](N)CCC(N)=O FTIJVMLAGRAYMJ-MNXVOIDGSA-N 0.000 description 1
- 101150087426 Gnal gene Proteins 0.000 description 1
- 108050002220 Green fluorescent protein, GFP Proteins 0.000 description 1
- 241000700721 Hepatitis B virus Species 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- WSDOHRLQDGAOGU-BQBZGAKWSA-N His-Asn Chemical compound NC(=O)C[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CN=CN1 WSDOHRLQDGAOGU-BQBZGAKWSA-N 0.000 description 1
- RXVOMIADLXPJGW-GUBZILKMSA-N His-Asp-Glu Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O RXVOMIADLXPJGW-GUBZILKMSA-N 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 101000971171 Homo sapiens Apoptosis regulator Bcl-2 Proteins 0.000 description 1
- 101000601724 Homo sapiens Paired box protein Pax-5 Proteins 0.000 description 1
- 206010062904 Hormone-refractory prostate cancer Diseases 0.000 description 1
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 1
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 1
- 206010021143 Hypoxia Diseases 0.000 description 1
- RENBRDSDKPSRIH-HJWJTTGWSA-N Ile-Phe-Met Chemical compound N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCSC)C(=O)O RENBRDSDKPSRIH-HJWJTTGWSA-N 0.000 description 1
- 102100023915 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 102000003746 Insulin Receptor Human genes 0.000 description 1
- 108010001127 Insulin Receptor Proteins 0.000 description 1
- 102000003814 Interleukin-10 Human genes 0.000 description 1
- 108090000174 Interleukin-10 Proteins 0.000 description 1
- 102000000646 Interleukin-3 Human genes 0.000 description 1
- 108010002386 Interleukin-3 Proteins 0.000 description 1
- 102000004388 Interleukin-4 Human genes 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 102000004890 Interleukin-8 Human genes 0.000 description 1
- 108090001007 Interleukin-8 Proteins 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- 235000019766 L-Lysine Nutrition 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- TYYLDKGBCJGJGW-UHFFFAOYSA-N L-tryptophan-L-tyrosine Natural products C=1NC2=CC=CC=C2C=1CC(N)C(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 TYYLDKGBCJGJGW-UHFFFAOYSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 239000012097 Lipofectamine 2000 Substances 0.000 description 1
- LLSUNJYOSCOOEB-GUBZILKMSA-N Lys-Glu-Asp Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O LLSUNJYOSCOOEB-GUBZILKMSA-N 0.000 description 1
- PBOUVYGPDSARIS-IUCAKERBSA-N Met-Leu Chemical compound CSCC[C@H](N)C(=O)N[C@H](C(O)=O)CC(C)C PBOUVYGPDSARIS-IUCAKERBSA-N 0.000 description 1
- 101100443763 Mus musculus Dock7 gene Proteins 0.000 description 1
- ZRKWMRDKSOPRRS-UHFFFAOYSA-N N-Methyl-N-nitrosourea Chemical compound O=NN(C)C(N)=O ZRKWMRDKSOPRRS-UHFFFAOYSA-N 0.000 description 1
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 1
- 230000004988 N-glycosylation Effects 0.000 description 1
- KZNQNBZMBZJQJO-UHFFFAOYSA-N N-glycyl-L-proline Natural products NCC(=O)N1CCCC1C(O)=O KZNQNBZMBZJQJO-UHFFFAOYSA-N 0.000 description 1
- 108091061960 Naked DNA Proteins 0.000 description 1
- 206010061309 Neoplasm progression Diseases 0.000 description 1
- GRYLNZFGIOXLOG-UHFFFAOYSA-N Nitric acid Chemical compound O[N+]([O-])=O GRYLNZFGIOXLOG-UHFFFAOYSA-N 0.000 description 1
- REYJJPSVUYRZGE-UHFFFAOYSA-N Octadecylamine Chemical compound CCCCCCCCCCCCCCCCCCN REYJJPSVUYRZGE-UHFFFAOYSA-N 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 239000012124 Opti-MEM Substances 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 108010032788 PAX6 Transcription Factor Proteins 0.000 description 1
- 239000002033 PVDF binder Substances 0.000 description 1
- 102100037504 Paired box protein Pax-5 Human genes 0.000 description 1
- 102100037506 Paired box protein Pax-6 Human genes 0.000 description 1
- 108010067372 Pancreatic elastase Proteins 0.000 description 1
- 102000016387 Pancreatic elastase Human genes 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- BQMFWUKNOCJDNV-HJWJTTGWSA-N Phe-Val-Ile Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O BQMFWUKNOCJDNV-HJWJTTGWSA-N 0.000 description 1
- ABLZXFCXXLZCGV-UHFFFAOYSA-N Phosphorous acid Chemical class OP(O)=O ABLZXFCXXLZCGV-UHFFFAOYSA-N 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 208000007452 Plasmacytoma Diseases 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 206010036940 Prostatic adenoma Diseases 0.000 description 1
- 238000004617 QSAR study Methods 0.000 description 1
- 102000014450 RNA Polymerase III Human genes 0.000 description 1
- 108010078067 RNA Polymerase III Proteins 0.000 description 1
- 238000010802 RNA extraction kit Methods 0.000 description 1
- 239000012979 RPMI medium Substances 0.000 description 1
- 208000015634 Rectal Neoplasms Diseases 0.000 description 1
- 108091081062 Repeated sequence (DNA) Proteins 0.000 description 1
- 241000712907 Retroviridae Species 0.000 description 1
- 102000004167 Ribonuclease P Human genes 0.000 description 1
- 108090000621 Ribonuclease P Proteins 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- 108091027967 Small hairpin RNA Proteins 0.000 description 1
- 241000251131 Sphyrna Species 0.000 description 1
- 208000000102 Squamous Cell Carcinoma of Head and Neck Diseases 0.000 description 1
- 101100054666 Streptomyces halstedii sch3 gene Proteins 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-N Succinic acid Natural products OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 1
- UCKMPCXJQFINFW-UHFFFAOYSA-N Sulphide Chemical compound [S-2] UCKMPCXJQFINFW-UHFFFAOYSA-N 0.000 description 1
- 206010042971 T-cell lymphoma Diseases 0.000 description 1
- 208000027585 T-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 239000006180 TBST buffer Substances 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- 241000223892 Tetrahymena Species 0.000 description 1
- GXDLGHLJTHMDII-WISUUJSJSA-N Thr-Ser Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](CO)C(O)=O GXDLGHLJTHMDII-WISUUJSJSA-N 0.000 description 1
- 108091036066 Three prime untranslated region Proteins 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 108010000499 Thromboplastin Proteins 0.000 description 1
- 108020004440 Thymidine kinase Proteins 0.000 description 1
- 102100030859 Tissue factor Human genes 0.000 description 1
- TYYLDKGBCJGJGW-WMZOPIPTSA-N Trp-Tyr Chemical compound C([C@H](NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)N)C(O)=O)C1=CC=C(O)C=C1 TYYLDKGBCJGJGW-WMZOPIPTSA-N 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 108010040002 Tumor Suppressor Proteins Proteins 0.000 description 1
- 102000001742 Tumor Suppressor Proteins Human genes 0.000 description 1
- LUMQYLVYUIRHHU-YJRXYDGGSA-N Tyr-Ser-Thr Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(O)=O LUMQYLVYUIRHHU-YJRXYDGGSA-N 0.000 description 1
- BMPPMAOOKQJYIP-WMZOPIPTSA-N Tyr-Trp Chemical compound C([C@H]([NH3+])C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C([O-])=O)C1=CC=C(O)C=C1 BMPPMAOOKQJYIP-WMZOPIPTSA-N 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 208000008385 Urogenital Neoplasms Diseases 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- DAVNYIUELQBTAP-XUXIUFHCSA-N Val-Leu-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C(C)C)N DAVNYIUELQBTAP-XUXIUFHCSA-N 0.000 description 1
- GVJUTBOZZBTBIG-AVGNSLFASA-N Val-Lys-Arg Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N GVJUTBOZZBTBIG-AVGNSLFASA-N 0.000 description 1
- 108020005202 Viral DNA Proteins 0.000 description 1
- RLXCFCYWFYXTON-JTTSDREOSA-N [(3S,8S,9S,10R,13S,14S,17R)-3-hydroxy-10,13-dimethyl-17-[(2R)-6-methylheptan-2-yl]-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1H-cyclopenta[a]phenanthren-16-yl] N-hexylcarbamate Chemical group C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC(OC(=O)NCCCCCC)[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 RLXCFCYWFYXTON-JTTSDREOSA-N 0.000 description 1
- ISXSJGHXHUZXNF-LXZPIJOJSA-N [(3s,8s,9s,10r,13r,14s,17r)-10,13-dimethyl-17-[(2r)-6-methylheptan-2-yl]-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1h-cyclopenta[a]phenanthren-3-yl] n-[2-(dimethylamino)ethyl]carbamate;hydrochloride Chemical compound Cl.C1C=C2C[C@@H](OC(=O)NCCN(C)C)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 ISXSJGHXHUZXNF-LXZPIJOJSA-N 0.000 description 1
- HMNZFMSWFCAGGW-XPWSMXQVSA-N [3-[hydroxy(2-hydroxyethoxy)phosphoryl]oxy-2-[(e)-octadec-9-enoyl]oxypropyl] (e)-octadec-9-enoate Chemical compound CCCCCCCC\C=C\CCCCCCCC(=O)OCC(COP(O)(=O)OCCO)OC(=O)CCCCCCC\C=C\CCCCCCCC HMNZFMSWFCAGGW-XPWSMXQVSA-N 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 235000011054 acetic acid Nutrition 0.000 description 1
- XVIYCJDWYLJQBG-UHFFFAOYSA-N acetic acid;adamantane Chemical compound CC(O)=O.C1C(C2)CC3CC1CC2C3 XVIYCJDWYLJQBG-UHFFFAOYSA-N 0.000 description 1
- 125000001539 acetonyl group Chemical group [H]C([H])([H])C(=O)C([H])([H])* 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- IVHDZUFNZLETBM-IWSIBTJSSA-N acridine red 3B Chemical compound [Cl-].C1=C\C(=[NH+]/C)C=C2OC3=CC(NC)=CC=C3C=C21 IVHDZUFNZLETBM-IWSIBTJSSA-N 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000011149 active material Substances 0.000 description 1
- 230000033289 adaptive immune response Effects 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 125000000848 adenin-9-yl group Chemical group [H]N([H])C1=C2N=C([H])N(*)C2=NC([H])=N1 0.000 description 1
- 208000009956 adenocarcinoma Diseases 0.000 description 1
- 229960005305 adenosine Drugs 0.000 description 1
- LNQVTSROQXJCDD-UHFFFAOYSA-N adenosine monophosphate Natural products C1=NC=2C(N)=NC=NC=2N1C1OC(CO)C(OP(O)(O)=O)C1O LNQVTSROQXJCDD-UHFFFAOYSA-N 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 238000012387 aerosolization Methods 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 230000001476 alcoholic effect Effects 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 150000001336 alkenes Chemical class 0.000 description 1
- 125000002877 alkyl aryl group Chemical group 0.000 description 1
- 125000005600 alkyl phosphonate group Chemical group 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 230000002152 alkylating effect Effects 0.000 description 1
- 230000000172 allergic effect Effects 0.000 description 1
- 230000003281 allosteric effect Effects 0.000 description 1
- UPEZCKBFRMILAV-UHFFFAOYSA-N alpha-Ecdysone Natural products C1C(O)C(O)CC2(C)C(CCC3(C(C(C(O)CCC(C)(C)O)C)CCC33O)C)C3=CC(=O)C21 UPEZCKBFRMILAV-UHFFFAOYSA-N 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 125000005122 aminoalkylamino group Chemical group 0.000 description 1
- 208000003455 anaphylaxis Diseases 0.000 description 1
- 229940035674 anesthetics Drugs 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 125000000129 anionic group Chemical group 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 239000002260 anti-inflammatory agent Substances 0.000 description 1
- 229940121363 anti-inflammatory agent Drugs 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 230000000845 anti-microbial effect Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 229940111121 antirheumatic drug quinolines Drugs 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- 238000003782 apoptosis assay Methods 0.000 description 1
- 239000008365 aqueous carrier Substances 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- 125000000637 arginyl group Chemical group N[C@@H](CCCNC(N)=N)C(=O)* 0.000 description 1
- 108010062796 arginyllysine Proteins 0.000 description 1
- 150000004982 aromatic amines Chemical class 0.000 description 1
- 125000003710 aryl alkyl group Chemical group 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 208000010668 atopic eczema Diseases 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 229940049706 benzodiazepine Drugs 0.000 description 1
- 125000003310 benzodiazepinyl group Chemical class N1N=C(C=CC2=C1C=CC=C2)* 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 230000002457 bidirectional effect Effects 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 239000000090 biomarker Substances 0.000 description 1
- 201000000053 blastoma Diseases 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 239000008366 buffered solution Substances 0.000 description 1
- KDYFGRWQOYBRFD-NUQCWPJISA-N butanedioic acid Chemical compound O[14C](=O)CC[14C](O)=O KDYFGRWQOYBRFD-NUQCWPJISA-N 0.000 description 1
- BPKIGYQJPYCAOW-FFJTTWKXSA-I calcium;potassium;disodium;(2s)-2-hydroxypropanoate;dichloride;dihydroxide;hydrate Chemical compound O.[OH-].[OH-].[Na+].[Na+].[Cl-].[Cl-].[K+].[Ca+2].C[C@H](O)C([O-])=O BPKIGYQJPYCAOW-FFJTTWKXSA-I 0.000 description 1
- 230000004611 cancer cell death Effects 0.000 description 1
- 239000003560 cancer drug Substances 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 108060001132 cathelicidin Proteins 0.000 description 1
- 102000014509 cathelicidin Human genes 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 238000003570 cell viability assay Methods 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 230000004700 cellular uptake Effects 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 208000019065 cervical carcinoma Diseases 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 238000001311 chemical methods and process Methods 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 229940044683 chemotherapy drug Drugs 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- BHQCQFFYRZLCQQ-OELDTZBJSA-N cholic acid Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)[C@@H](O)C1 BHQCQFFYRZLCQQ-OELDTZBJSA-N 0.000 description 1
- 235000019416 cholic acid Nutrition 0.000 description 1
- 229960002471 cholic acid Drugs 0.000 description 1
- 208000037976 chronic inflammation Diseases 0.000 description 1
- 230000006020 chronic inflammation Effects 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- 230000007012 clinical effect Effects 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 230000008045 co-localization Effects 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 230000009137 competitive binding Effects 0.000 description 1
- 230000006957 competitive inhibition Effects 0.000 description 1
- 238000010205 computational analysis Methods 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 239000012059 conventional drug carrier Substances 0.000 description 1
- 150000001907 coumarones Chemical class 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 230000037029 cross reaction Effects 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 125000004122 cyclic group Chemical group 0.000 description 1
- 125000001995 cyclobutyl group Chemical group [H]C1([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 239000000824 cytostatic agent Substances 0.000 description 1
- 230000001085 cytostatic effect Effects 0.000 description 1
- RGWHQCVHVJXOKC-SHYZEUOFSA-J dCTP(4-) Chemical compound O=C1N=C(N)C=CN1[C@@H]1O[C@H](COP([O-])(=O)OP([O-])(=O)OP([O-])([O-])=O)[C@@H](O)C1 RGWHQCVHVJXOKC-SHYZEUOFSA-J 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 230000000593 degrading effect Effects 0.000 description 1
- 239000003405 delayed action preparation Substances 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- KXGVEGMKQFWNSR-UHFFFAOYSA-N deoxycholic acid Natural products C1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)C(O)C2 KXGVEGMKQFWNSR-UHFFFAOYSA-N 0.000 description 1
- 238000001212 derivatisation Methods 0.000 description 1
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 1
- 229960003957 dexamethasone Drugs 0.000 description 1
- NAGJZTKCGNOGPW-UHFFFAOYSA-K dioxido-sulfanylidene-sulfido-$l^{5}-phosphane Chemical compound [O-]P([O-])([S-])=S NAGJZTKCGNOGPW-UHFFFAOYSA-K 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- 229960003722 doxycycline Drugs 0.000 description 1
- 239000003651 drinking water Substances 0.000 description 1
- 235000020188 drinking water Nutrition 0.000 description 1
- 239000006196 drop Substances 0.000 description 1
- 229940000406 drug candidate Drugs 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- UPEZCKBFRMILAV-JMZLNJERSA-N ecdysone Chemical compound C1[C@@H](O)[C@@H](O)C[C@]2(C)[C@@H](CC[C@@]3([C@@H]([C@@H]([C@H](O)CCC(C)(C)O)C)CC[C@]33O)C)C3=CC(=O)[C@@H]21 UPEZCKBFRMILAV-JMZLNJERSA-N 0.000 description 1
- 108010057988 ecdysone receptor Proteins 0.000 description 1
- 230000005014 ectopic expression Effects 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000002337 electrophoretic mobility shift assay Methods 0.000 description 1
- 201000008184 embryoma Diseases 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 210000001163 endosome Anatomy 0.000 description 1
- 210000003989 endothelium vascular Anatomy 0.000 description 1
- 108010048367 enhanced green fluorescent protein Proteins 0.000 description 1
- 230000006862 enzymatic digestion Effects 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 201000005619 esophageal carcinoma Diseases 0.000 description 1
- 150000002169 ethanolamines Chemical class 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 235000013861 fat-free Nutrition 0.000 description 1
- 239000012091 fetal bovine serum Substances 0.000 description 1
- 230000003619 fibrillary effect Effects 0.000 description 1
- 239000010408 film Substances 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 235000019253 formic acid Nutrition 0.000 description 1
- 230000037433 frameshift Effects 0.000 description 1
- 239000001530 fumaric acid Substances 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- BTCSSZJGUNDROE-UHFFFAOYSA-N gamma-aminobutyric acid Chemical compound NCCCC(O)=O BTCSSZJGUNDROE-UHFFFAOYSA-N 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 238000001476 gene delivery Methods 0.000 description 1
- 238000012226 gene silencing method Methods 0.000 description 1
- 239000003193 general anesthetic agent Substances 0.000 description 1
- 231100000024 genotoxic Toxicity 0.000 description 1
- 230000001738 genotoxic effect Effects 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 208000005017 glioblastoma Diseases 0.000 description 1
- 108060003196 globin Proteins 0.000 description 1
- 102000018146 globin Human genes 0.000 description 1
- 239000003292 glue Substances 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- KZNQNBZMBZJQJO-YFKPBYRVSA-N glyclproline Chemical compound NCC(=O)N1CCC[C@H]1C(O)=O KZNQNBZMBZJQJO-YFKPBYRVSA-N 0.000 description 1
- 125000003827 glycol group Chemical group 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 108010077515 glycylproline Proteins 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 125000003738 guanin-9-yl group Chemical group O=C1N([H])C(N([H])[H])=NC2=C1N=C([H])N2[*] 0.000 description 1
- 229940029575 guanosine Drugs 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 201000003911 head and neck carcinoma Diseases 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 201000000459 head and neck squamous cell carcinoma Diseases 0.000 description 1
- 210000002443 helper t lymphocyte Anatomy 0.000 description 1
- 201000005787 hematologic cancer Diseases 0.000 description 1
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 1
- 210000003494 hepatocyte Anatomy 0.000 description 1
- 125000005842 heteroatom Chemical group 0.000 description 1
- 125000000623 heterocyclic group Chemical group 0.000 description 1
- 125000000592 heterocycloalkyl group Chemical group 0.000 description 1
- 208000029824 high grade glioma Diseases 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 201000000284 histiocytoma Diseases 0.000 description 1
- 210000003917 human chromosome Anatomy 0.000 description 1
- WJRBRSLFGCUECM-UHFFFAOYSA-N hydantoin Chemical compound O=C1CNC(=O)N1 WJRBRSLFGCUECM-UHFFFAOYSA-N 0.000 description 1
- 229940091173 hydantoin Drugs 0.000 description 1
- 229920001600 hydrophobic polymer Polymers 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-M hydroxide Chemical compound [OH-] XLYOFNOQVPJJNP-UHFFFAOYSA-M 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 230000033444 hydroxylation Effects 0.000 description 1
- 238000005805 hydroxylation reaction Methods 0.000 description 1
- 230000001146 hypoxic effect Effects 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 239000012133 immunoprecipitate Substances 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 238000002513 implantation Methods 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 150000002475 indoles Chemical class 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 230000006882 induction of apoptosis Effects 0.000 description 1
- 239000011261 inert gas Substances 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 238000013383 initial experiment Methods 0.000 description 1
- 210000005007 innate immune system Anatomy 0.000 description 1
- 150000007529 inorganic bases Chemical class 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 239000000138 intercalating agent Substances 0.000 description 1
- 229940076144 interleukin-10 Drugs 0.000 description 1
- 229940076264 interleukin-3 Drugs 0.000 description 1
- 229940028885 interleukin-4 Drugs 0.000 description 1
- XKTZWUACRZHVAN-VADRZIEHSA-N interleukin-8 Chemical compound C([C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@@H](NC(C)=O)CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CCSC)C(=O)N1[C@H](CCC1)C(=O)N1[C@H](CCC1)C(=O)N[C@@H](C)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CCC(O)=O)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CC=1C=CC(O)=CC=1)C(=O)N[C@H](CO)C(=O)N1[C@H](CCC1)C(N)=O)C1=CC=CC=C1 XKTZWUACRZHVAN-VADRZIEHSA-N 0.000 description 1
- 229940096397 interleukin-8 Drugs 0.000 description 1
- 201000002313 intestinal cancer Diseases 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 125000000741 isoleucyl group Chemical group [H]N([H])C(C(C([H])([H])[H])C([H])([H])C([H])([H])[H])C(=O)O* 0.000 description 1
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- 150000002537 isoquinolines Chemical class 0.000 description 1
- 229950003188 isovaleryl diethylamide Drugs 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 238000011813 knockout mouse model Methods 0.000 description 1
- 239000004310 lactic acid Substances 0.000 description 1
- 235000014655 lactic acid Nutrition 0.000 description 1
- 150000002605 large molecules Chemical class 0.000 description 1
- 210000000867 larynx Anatomy 0.000 description 1
- 125000001909 leucine group Chemical group [H]N(*)C(C(*)=O)C([H])([H])C(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 238000003468 luciferase reporter gene assay Methods 0.000 description 1
- 238000004020 luminiscence type Methods 0.000 description 1
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 239000012139 lysis buffer Substances 0.000 description 1
- 108010044348 lysyl-glutamyl-aspartic acid Proteins 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- UEGPKNKPLBYCNK-UHFFFAOYSA-L magnesium acetate Chemical compound [Mg+2].CC([O-])=O.CC([O-])=O UEGPKNKPLBYCNK-UHFFFAOYSA-L 0.000 description 1
- 239000011654 magnesium acetate Substances 0.000 description 1
- 235000011285 magnesium acetate Nutrition 0.000 description 1
- 229940069446 magnesium acetate Drugs 0.000 description 1
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 1
- 239000011976 maleic acid Substances 0.000 description 1
- 201000011614 malignant glioma Diseases 0.000 description 1
- 210000000415 mammalian chromosome Anatomy 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 238000010297 mechanical methods and process Methods 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 102000006240 membrane receptors Human genes 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 208000037819 metastatic cancer Diseases 0.000 description 1
- 208000011575 metastatic malignant neoplasm Diseases 0.000 description 1
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 238000009126 molecular therapy Methods 0.000 description 1
- 125000004573 morpholin-4-yl group Chemical group N1(CCOCC1)* 0.000 description 1
- 230000004660 morphological change Effects 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 201000005962 mycosis fungoides Diseases 0.000 description 1
- 208000025113 myeloid leukemia Diseases 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- VMGAPWLDMVPYIA-HIDZBRGKSA-N n'-amino-n-iminomethanimidamide Chemical compound N\N=C\N=N VMGAPWLDMVPYIA-HIDZBRGKSA-N 0.000 description 1
- 230000009826 neoplastic cell growth Effects 0.000 description 1
- 201000011682 nervous system cancer Diseases 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 239000002547 new drug Substances 0.000 description 1
- 229910017604 nitric acid Inorganic materials 0.000 description 1
- 231100000957 no side effect Toxicity 0.000 description 1
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 1
- 230000004987 nonapoptotic effect Effects 0.000 description 1
- 231100000065 noncytotoxic Toxicity 0.000 description 1
- 230000002020 noncytotoxic effect Effects 0.000 description 1
- 239000000346 nonvolatile oil Substances 0.000 description 1
- 238000010899 nucleation Methods 0.000 description 1
- 238000001668 nucleic acid synthesis Methods 0.000 description 1
- 150000003833 nucleoside derivatives Chemical class 0.000 description 1
- 125000003835 nucleoside group Chemical group 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- 150000002895 organic esters Chemical class 0.000 description 1
- 125000001181 organosilyl group Chemical group [SiH3]* 0.000 description 1
- 235000006408 oxalic acid Nutrition 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- ONTNXMBMXUNDBF-UHFFFAOYSA-N pentatriacontane-17,18,19-triol Chemical compound CCCCCCCCCCCCCCCCC(O)C(O)C(O)CCCCCCCCCCCCCCCC ONTNXMBMXUNDBF-UHFFFAOYSA-N 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 235000020030 perry Nutrition 0.000 description 1
- 230000003285 pharmacodynamic effect Effects 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 210000003800 pharynx Anatomy 0.000 description 1
- 125000000405 phenylalanyl group Chemical group 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 150000008298 phosphoramidates Chemical class 0.000 description 1
- 125000004437 phosphorous atom Chemical group 0.000 description 1
- 229910052698 phosphorus Inorganic materials 0.000 description 1
- 238000000053 physical method Methods 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229920000768 polyamine Polymers 0.000 description 1
- 229930001119 polyketide Natural products 0.000 description 1
- 125000000830 polyketide group Chemical group 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 230000032361 posttranscriptional gene silencing Effects 0.000 description 1
- 230000001323 posttranslational effect Effects 0.000 description 1
- 235000011056 potassium acetate Nutrition 0.000 description 1
- GUUBJKMBDULZTE-UHFFFAOYSA-M potassium;2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid;hydroxide Chemical compound [OH-].[K+].OCCN1CCN(CCS(O)(=O)=O)CC1 GUUBJKMBDULZTE-UHFFFAOYSA-M 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000037452 priming Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 230000005522 programmed cell death Effects 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 238000012342 propidium iodide staining Methods 0.000 description 1
- 235000019260 propionic acid Nutrition 0.000 description 1
- 201000005825 prostate adenocarcinoma Diseases 0.000 description 1
- 201000001514 prostate carcinoma Diseases 0.000 description 1
- 235000019833 protease Nutrition 0.000 description 1
- 210000004777 protein coat Anatomy 0.000 description 1
- 230000004853 protein function Effects 0.000 description 1
- 230000006916 protein interaction Effects 0.000 description 1
- 108010030416 proteoliposomes Proteins 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 239000002213 purine nucleotide Substances 0.000 description 1
- 229940107700 pyruvic acid Drugs 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- IUVKMZGDUIUOCP-BTNSXGMBSA-N quinbolone Chemical compound O([C@H]1CC[C@H]2[C@H]3[C@@H]([C@]4(C=CC(=O)C=C4CC3)C)CC[C@@]21C)C1=CCCC1 IUVKMZGDUIUOCP-BTNSXGMBSA-N 0.000 description 1
- 150000003248 quinolines Chemical class 0.000 description 1
- 230000008707 rearrangement Effects 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 201000010174 renal carcinoma Diseases 0.000 description 1
- BOLDJAUMGUJJKM-LSDHHAIUSA-N renifolin D Natural products CC(=C)[C@@H]1Cc2c(O)c(O)ccc2[C@H]1CC(=O)c3ccc(O)cc3O BOLDJAUMGUJJKM-LSDHHAIUSA-N 0.000 description 1
- 125000006853 reporter group Chemical group 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 210000001991 scapula Anatomy 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- IIACRCGMVDHOTQ-UHFFFAOYSA-N sulfamic acid Chemical group NS(O)(=O)=O IIACRCGMVDHOTQ-UHFFFAOYSA-N 0.000 description 1
- NVBFHJWHLNUMCV-UHFFFAOYSA-N sulfamide Chemical class NS(N)(=O)=O NVBFHJWHLNUMCV-UHFFFAOYSA-N 0.000 description 1
- 230000019635 sulfation Effects 0.000 description 1
- 238000005670 sulfation reaction Methods 0.000 description 1
- 150000003456 sulfonamides Chemical group 0.000 description 1
- BDHFUVZGWQCTTF-UHFFFAOYSA-M sulfonate Chemical compound [O-]S(=O)=O BDHFUVZGWQCTTF-UHFFFAOYSA-M 0.000 description 1
- 150000003457 sulfones Chemical group 0.000 description 1
- 150000003462 sulfoxides Chemical class 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 238000012353 t test Methods 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- 150000003530 tetrahydroquinolines Chemical class 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 150000003568 thioethers Chemical class 0.000 description 1
- 229930192474 thiophene Natural products 0.000 description 1
- 150000003577 thiophenes Chemical class 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- 125000003294 thymin-1-yl group Chemical group [H]N1C(=O)N(*)C([H])=C(C1=O)C([H])([H])[H] 0.000 description 1
- 229940113082 thymine Drugs 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 238000002627 tracheal intubation Methods 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 125000005270 trialkylamine group Chemical group 0.000 description 1
- ZMANZCXQSJIPKH-UHFFFAOYSA-O triethylammonium ion Chemical compound CC[NH+](CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-O 0.000 description 1
- 125000000876 trifluoromethoxy group Chemical group FC(F)(F)O* 0.000 description 1
- 125000002023 trifluoromethyl group Chemical group FC(F)(F)* 0.000 description 1
- 230000001228 trophic effect Effects 0.000 description 1
- 230000010415 tropism Effects 0.000 description 1
- 108010044292 tryptophyltyrosine Proteins 0.000 description 1
- 230000005740 tumor formation Effects 0.000 description 1
- 230000005751 tumor progression Effects 0.000 description 1
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 1
- 230000005760 tumorsuppression Effects 0.000 description 1
- 239000010981 turquoise Substances 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 125000002948 undecyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 125000000845 uracil-1-yl group Chemical group [*]N1C(=O)N([H])C(=O)C([H])=C1[H] 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 125000002987 valine group Chemical group [H]N([H])C([H])(C(*)=O)C([H])(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 210000002845 virion Anatomy 0.000 description 1
- 229940075420 xanthine Drugs 0.000 description 1
- 238000001086 yeast two-hybrid system Methods 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/115—Aptamers, i.e. nucleic acids binding a target molecule specifically and with high affinity without hybridising therewith ; Nucleic acids binding to non-nucleic acids, e.g. aptamers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4723—Cationic antimicrobial peptides, e.g. defensins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/11—Antisense
- C12N2310/111—Antisense spanning the whole gene, or a large part of it
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/14—Type of nucleic acid interfering N.A.
Abstract
Provided is a method of treating cancer in a subject by inhibiting expression of PAX2. An example of a cancer treated by the present method is prostate cancer. Similarly, provided is a method of treating cancer in a subject by increasing expression of DEFBl in the subject. In the method wherein the expression of DEFBl is increased, it can be increased by blocking the binding of PAX2 to the DEFBl promoter. Blocking the binding of PAX2 to the DEFBl promoter can be by administration of an oligonucleotide containing the PAX2 DNA binding site of DEFBl. This oligonucleotide can be complementary to the sequence of PAX2 that binds to the DEFBl promoter. Alternatively, the oligonucleotide can interact with the PAX2 in a way that inhibits binding to DEFBl.
Description
IMMUNITY AND CANCER THERAPY
Brief Description of Invention Current anticancer chemotherapies that are based on alkylating agents, anti-metabolites and natural products are heterogeneous in their mechanism of action.
Consequently, most of them also act against normal cells resulting in severe side effects and toxicity to the patient. Disclosed herein is a method for the treatment of advanced prostate cancer using human beta defensin-1 (DEFB1), which is a naturally component of the innate immune system, to induce prostate cancer tumor immunity. This is accomplished through endogenously added DEFB 1, ectopically expressed DEFB1 or de novo expression of DEFB1 by inhibiting the transcriptional repressor PAX2 by a variety of mechanisms or agents. Inhibiting PAX2 expression by siRNA therapy turns on DEFB1 expression and generates DEFB1-mediated cell death in prostate cancer. With this, the technology described here is used for the design of small molecules to specifically block expression. Alternatively provided are molecules containing the CCTTG (SEQ ID
NO: 1) recognition sequence (in either forward of reverse orientation) that to bind to the DNA-binding domain of PAX2 preventing its binding to the DEFB1 promoter through competitive inhibition. This permits DEFB1 expression, triggering both an innate and adaptive immune response, and resulting in the killing of prostate cancer cells and the suppression of prostate tumor formation. In conclusion, these modulators of innate tumor immunity, PAX2 and DEFB1, and the molecular therapies based on them provide, for the treatment of prostate cancer with little toxicity to the patient.
BRIEF DESCRIPTION OF THE DRAWINGS
The accompanying drawings illustrate one or more embodiments of the invention and, together with the written description, serve to explain the principles of the invention.
Wherever possible, the same reference numbers are used throughout the drawings to refer to the same or like elements of an embodiment.
Figure 1. QRT-PCR analysis of DEFB1 Expression. In order to verify induction of DEFB1 expression, QRT-PCR was performed. A, DEFB1 relative expression levels were compared in clinical samples from 6 patients that underwent radical prostatectomies. B, DEFB 1 relative expression levels were compared in benign and malignant prostatic clinical samples, hPrEC cells and in prostate cancer cell lines before and after DEFBl induction. C, DEFB1 relative expression levels were analyzed in benign tissue, malignant tissue and PIN
in a single tissue section. D, DEFB 1 expression in benign tissue, malignant tissue and PIN
in one patient was compared to the average DEFB 1 expression level found in benign tissue.
Figure 2. Microscopic analysis of DEFB1 induced changes in membrane integrity and cell morphology. Cell morphology of DU145, PC3 and LNCaP was analyzed by phase contrast microscopy after 48 hours of DEFBl induction. Membrane ruffling is indicated by black arrows and apoptotic bodies are indicated white arrows.
Figure 3. Analysis of DEFBl Cytotoxicity in Prostate Cancer Cells. The prostate cell lines DU145, PC3 and LNCaP were treated with PonA to induce DEFB1 expression for 1-3 days after which MTT assay was performed to determine cell viability.. Results represent mean s.d., n=9.
Figure 4. Induction of cell death in DU145 and PC3 cells by DEFB1. DEFB1 expression was induced in prostate cancer cell lines DU145 (A) and PC3 (B) and then subjected. to annexin V/FITC/propidium iodide staining and flow cytometric analy.sis., Cells positive for propidium iodide and annexin V were considered apoptotic. Times of induction are shown under each panel. Numbers next to the boxes for each time point represent the percentages of propidium iodide (PI)- annexin V+ cells (lower right quadrant), and PI+
annexin V' cells (upper right quadrant). The data are from a single experiment that is representative of three separate experiments.
Figure 5. Pan-caspase analysis following DEFB1 induction. DU145 and PC3 cells were stained with FAM-VAD-FMK-labeled fluoromethyl ketone to detect caspase activity. Cells were visible under DIC for each condition. Confocal microscopic analysis revealed no caspase staining in control DU145 (B), PC3 cells (F) and LNCaP (J). Cells treated with PonA for 24 hours to induce DEFBl revealed caspase activity in DU145 (D) and PC3 (H).
No caspase activity was detected in LNCaP (L).
Figure 6. Silencing of PAX2 Protein Expression Following PAX2 siRNA Treatment.
(a) Western blot analysis of PC3 and DU145 cells transfected with PAX2 siRNA
duplex at day zero (lane 1), day two (lane 2), and day four (lane 3). (b) Western blot analysis of PC3 and DU145 cells transfected with PAX2 siRNA duplex at day zero (lane 1), day two (lane 2), day four (lane 3) and day 6 (lane 4). PAX2 protein was undetectable as early as after four days of treatment (lane 3) in DU145 cells and after six days of treatment in PC3. Blots were stripped and re-probed for,6-actin as an internal control.
Figure 7. Analysis of Prostate Cancer Cells Growth after Treatment with Pax 2 siRNA. Phase contrast microscopic analysis of DU145, PC3 and LNCaP at 6 days in the presence of normal growth media. Treatment with negative control siRNA had no effect on the cells. However, there was a significant reduction in cell number in all three lines following treatment with PAX2 siRNA.
Figure S. Analysis of Cell Death Following siRNA Silencing of PAX2. Prostate cancer cell lines PC3, DU145, and LNCaP were treated with 0.5 g of a pool of four siRNA's or four non-specific control siRNA's for 2, 4 or 6 days after which MTT assay was done to determine cell viability. Results represent mean s.d., n=9.
Figure 9. Analysis of Caspase Activity. DU145, PC3 and LNCaP cells were stained with carboxyfluorescein-labeled fluoromethyl ketone to detected caspase activity following treatment with PAX2 siRNA. Confocal microscopic analysis of untreated and treated cells show cells were visible with DIC. Analysis under fluorescence revealed no caspase staining in control DU145 (B), PC3 cells (F) and LNCaP cells (J). However, cell treated with PAX2 siRNA induced caspase activity in DU145 (D), PC3 (H) and LNCaP (L).
Figure 10. Analysis of Apoptotic Factors Following PAX2 siRNA Treatment.
Changes in expression of pro-apoptotic factors were compared in untreated control cells and in cells treated for six days with PAX2 siRNA. A, BAX expression levels increased in DU145, PC3 and LNCaP. B, BID expression increased in DU145 and LNCaP, but change in PC3.
C, BAD expression levels increased in all three cell lines.
Brief Description of Invention Current anticancer chemotherapies that are based on alkylating agents, anti-metabolites and natural products are heterogeneous in their mechanism of action.
Consequently, most of them also act against normal cells resulting in severe side effects and toxicity to the patient. Disclosed herein is a method for the treatment of advanced prostate cancer using human beta defensin-1 (DEFB1), which is a naturally component of the innate immune system, to induce prostate cancer tumor immunity. This is accomplished through endogenously added DEFB 1, ectopically expressed DEFB1 or de novo expression of DEFB1 by inhibiting the transcriptional repressor PAX2 by a variety of mechanisms or agents. Inhibiting PAX2 expression by siRNA therapy turns on DEFB1 expression and generates DEFB1-mediated cell death in prostate cancer. With this, the technology described here is used for the design of small molecules to specifically block expression. Alternatively provided are molecules containing the CCTTG (SEQ ID
NO: 1) recognition sequence (in either forward of reverse orientation) that to bind to the DNA-binding domain of PAX2 preventing its binding to the DEFB1 promoter through competitive inhibition. This permits DEFB1 expression, triggering both an innate and adaptive immune response, and resulting in the killing of prostate cancer cells and the suppression of prostate tumor formation. In conclusion, these modulators of innate tumor immunity, PAX2 and DEFB1, and the molecular therapies based on them provide, for the treatment of prostate cancer with little toxicity to the patient.
BRIEF DESCRIPTION OF THE DRAWINGS
The accompanying drawings illustrate one or more embodiments of the invention and, together with the written description, serve to explain the principles of the invention.
Wherever possible, the same reference numbers are used throughout the drawings to refer to the same or like elements of an embodiment.
Figure 1. QRT-PCR analysis of DEFB1 Expression. In order to verify induction of DEFB1 expression, QRT-PCR was performed. A, DEFB1 relative expression levels were compared in clinical samples from 6 patients that underwent radical prostatectomies. B, DEFB 1 relative expression levels were compared in benign and malignant prostatic clinical samples, hPrEC cells and in prostate cancer cell lines before and after DEFBl induction. C, DEFB1 relative expression levels were analyzed in benign tissue, malignant tissue and PIN
in a single tissue section. D, DEFB 1 expression in benign tissue, malignant tissue and PIN
in one patient was compared to the average DEFB 1 expression level found in benign tissue.
Figure 2. Microscopic analysis of DEFB1 induced changes in membrane integrity and cell morphology. Cell morphology of DU145, PC3 and LNCaP was analyzed by phase contrast microscopy after 48 hours of DEFBl induction. Membrane ruffling is indicated by black arrows and apoptotic bodies are indicated white arrows.
Figure 3. Analysis of DEFBl Cytotoxicity in Prostate Cancer Cells. The prostate cell lines DU145, PC3 and LNCaP were treated with PonA to induce DEFB1 expression for 1-3 days after which MTT assay was performed to determine cell viability.. Results represent mean s.d., n=9.
Figure 4. Induction of cell death in DU145 and PC3 cells by DEFB1. DEFB1 expression was induced in prostate cancer cell lines DU145 (A) and PC3 (B) and then subjected. to annexin V/FITC/propidium iodide staining and flow cytometric analy.sis., Cells positive for propidium iodide and annexin V were considered apoptotic. Times of induction are shown under each panel. Numbers next to the boxes for each time point represent the percentages of propidium iodide (PI)- annexin V+ cells (lower right quadrant), and PI+
annexin V' cells (upper right quadrant). The data are from a single experiment that is representative of three separate experiments.
Figure 5. Pan-caspase analysis following DEFB1 induction. DU145 and PC3 cells were stained with FAM-VAD-FMK-labeled fluoromethyl ketone to detect caspase activity. Cells were visible under DIC for each condition. Confocal microscopic analysis revealed no caspase staining in control DU145 (B), PC3 cells (F) and LNCaP (J). Cells treated with PonA for 24 hours to induce DEFBl revealed caspase activity in DU145 (D) and PC3 (H).
No caspase activity was detected in LNCaP (L).
Figure 6. Silencing of PAX2 Protein Expression Following PAX2 siRNA Treatment.
(a) Western blot analysis of PC3 and DU145 cells transfected with PAX2 siRNA
duplex at day zero (lane 1), day two (lane 2), and day four (lane 3). (b) Western blot analysis of PC3 and DU145 cells transfected with PAX2 siRNA duplex at day zero (lane 1), day two (lane 2), day four (lane 3) and day 6 (lane 4). PAX2 protein was undetectable as early as after four days of treatment (lane 3) in DU145 cells and after six days of treatment in PC3. Blots were stripped and re-probed for,6-actin as an internal control.
Figure 7. Analysis of Prostate Cancer Cells Growth after Treatment with Pax 2 siRNA. Phase contrast microscopic analysis of DU145, PC3 and LNCaP at 6 days in the presence of normal growth media. Treatment with negative control siRNA had no effect on the cells. However, there was a significant reduction in cell number in all three lines following treatment with PAX2 siRNA.
Figure S. Analysis of Cell Death Following siRNA Silencing of PAX2. Prostate cancer cell lines PC3, DU145, and LNCaP were treated with 0.5 g of a pool of four siRNA's or four non-specific control siRNA's for 2, 4 or 6 days after which MTT assay was done to determine cell viability. Results represent mean s.d., n=9.
Figure 9. Analysis of Caspase Activity. DU145, PC3 and LNCaP cells were stained with carboxyfluorescein-labeled fluoromethyl ketone to detected caspase activity following treatment with PAX2 siRNA. Confocal microscopic analysis of untreated and treated cells show cells were visible with DIC. Analysis under fluorescence revealed no caspase staining in control DU145 (B), PC3 cells (F) and LNCaP cells (J). However, cell treated with PAX2 siRNA induced caspase activity in DU145 (D), PC3 (H) and LNCaP (L).
Figure 10. Analysis of Apoptotic Factors Following PAX2 siRNA Treatment.
Changes in expression of pro-apoptotic factors were compared in untreated control cells and in cells treated for six days with PAX2 siRNA. A, BAX expression levels increased in DU145, PC3 and LNCaP. B, BID expression increased in DU145 and LNCaP, but change in PC3.
C, BAD expression levels increased in all three cell lines.
Figure 11. Model of PAX2 Binding to DNA Recognition Sequence. The PAX2 transcriptional repressor binds to a CCTTG (SEQ ID NO:1) recognition site immediately adjacent to the DEFB 1 TATA box preventing transcription and DEFB1 protein expression.
Inhibition of PAX2 protein expression allows normal DEFB 1 expression.
Figure 12. Illustration of the DEFB1 Reporter Construct. The DEFB1 promoter consisting of the first 160 bases upstream of the mRNA start site was PCR
amplified from DU145 cell and ligated into the pGL3 luciferase reporter plasmid.
Figure 13. Inhibition of PAX2 Results in DEFB1 Expression. DU145, PC3, LNCaP
and HPrEC were treated for 48 hours with PAX2 siRNA. QRT-PCR analysis before treatment showed no DEFB1 expression in DU145, PC3 and LNCaP. However, DEFB1 expression was restored following treatment in all lines. There was no change in DEFB1 expression following siRNA treatment of PAX2-null HprEC.
Figure 14. Inhibition of PAX2 Results in Increased DEFB1 Promoter Activity.
promoter/pGL3 and DU145 promoter/pGL3, construct were generated and were transfected into PC3 and DU145 cells, respectively. Promoter activity was compared before and after PAX2 inhibition by siRNA treatment. DEFB 1 promoter activity increased 2.65-fold in DU145 and 3.78 fold in PC3 following treatment.
Figure 15. DEFB1 Causes Loss of Membrane Integrity. Membrane integrity of PC3 and DU145 cells was analyzed by confocal laser microscopy following the induction of DEFB 1 expression for 48 hours. Green staining was indicative of the localization of AO, and red staining represents EtBr. Yellow staining represents the co-localization of both AO and EtBr in the nucleus.
Figure 16. PAX2 Inhibition Results in Loss of Membrane Integrity. Cells were treated for 48 hours with PAX2 siRNA and membrane integrity was analyzed by confocal laser microscopy.
Figure 17. ChIP Analysis of PAX2 binding to DEFB1 Promoter. ChIP analysis was performed on DU145 and PC3 cells. Following immunoprecipitation with an anti-antibody, PCR was performed to detect the DEFB 1 promoter region containing the GTTCC
PAX2 recognition site. This demonstrates that the PAX2 transcriptional repressor is bound to the DEFB 1 promoter in prostate cancer cell lines.
Figure 18. Predicted Structure of the PrdPD and PrdHD with DNA. The coordinates of the structures of the PrdPD bound to DNA (Xu et al., 1995 and the PrdHD
bound to DNA (Wilson et al., 1995) were used to construct a model of the two domains as they bound to a PHO site. The individual binding sites are abutted next to each other with a specific orientation as indicated. The PAI binding site is in red, the HD
binding site is in blue, and the corresponding PAI domain is in turquoise, and HD is in yellow.
The RED
domain is oriented based on the PrdPD crystal structure.
Figure 19. Comparison of Consensus Sequences of Different Paired Domains. At the top of the Figure is drawn a schematic representation of protein-4:DNA
contacts described in the crystallographic analysis of the Prd-paired-domain -DNA complex [91. Empty boxes indicate a-helices, shaded boxes indicates b-sheets and a thick line indicate a b-turn.
Contacting amino acids are shown by single-letter code. Only direct amino acid base 'contacts are shown. Empty circles indicate major groove contacts while red arrows indicate minor groove contacts. This scheme is aligned to all known consensus sequences for paired-domain proteins (top strands only are shown). Vertical lines between consensus sequences indicate conserved base-pairs. Numbering of the positions is shown at the bottom of the Figure and it is the same as that used in [9]".
DETAILED DESCRIPTION OF THE INVENTION
As shown herein, PAX2 inhibits expression of DEFB 1, and DEFB 1 is shown to have tumor cell killing activity. Thus, provided is a method of treating cancer in a subject by inhibiting expression of PAX2. An example of a cancer treated by the present method is prostate cancer. The present methods are particularly effective for treatment of late stage prostate cancer.
In the cancer treatment methods disclosed, the method of inhibiting expression of PAX 2 can be by administration of a nucleic acid encoding a siRNA for PAX 2.
Dharmachon is a commercial source for such siRNAs.
The siRNA for use in the methods can be selected from the group consisting of:
AUAGACUCGACUUGACUUCUU (SEQ ID NO:2) AUCUUCAUCACGUUUCCUCUU (SEQ ID NO:4) GUAUUCAGCAAUCUUGUCCUU (SEQ ID NO:6) GAUUUGAUGUGCUCUGAUGUU (SEQ ID NO:8) The following table illustrates the above antisense sequences and their corresponding sense sequences.
Sense (5'-3') Antisense (5'-3') Sequence A 5'- GAAGUCAAGUCGAGUCUAUUU-3' 5'-AUAGACUCGACUUGACUUCUU-3' Sequence B 5'-GAGGAAACGUGAUGAAGAUUU-3' 5'-AUCUUCAUCACGUUUCCUCUU-3' Sequence C 5'-GGACAAGAUUGCUGAAUACUU-3' 5'-GUAUUCAGCAAUCUUGUCCUU-3' Sequence D 5'-CAUCAGAGCA-CAUCAAAUCUU-3' 5'-GAUUUGAUGUGCUCUGAUGUU-3' Further examples of molecules that inhibit PAX2 include:
#1 ACCCGACTATGTTCGCCTGG (SEQ ID NO:XXX), #2 AAGCTCTGGATCGAGTCTTTG (SEQ ID NO:XXX), and #4 ATGTGTCAGGCACACAGACG (SEQ ID NO:XXX). #4 was shown to inhibit PAX2 (Davies et al., Hum. Mol. Gen Jan. 15, 13 (2); 235).
. Another paper (Muratovska et al., Paired-Box genes are frequently expressed in cancer and often required for cancer cell survival Oncogene (2003) 22, 7989-7997) discloses the following siRNAs: GUCGAGUCUAUCUGCAUCCTT (SEQ ID NO:xxx) and GGAUGCAGAUAGACUCGACTT (SEQ ID NO:XXX).
To down-regulate Pax2 expression, Fonsato et al. transfected tumor-derived endothelial cells with an anti-sense PAX2 vector. See Fonsato V. et al (Expression of Pax2 in human renal tumor-derived endothelial cells sustains apoptosis resistance and angiogenesis, Am J Pathol. 2006 Feb;168(2):706-1), incorporated herein by referene for its description of this molecule. Similarly, Hueber et al. teach that PAX2 antisense eDNA and PAX2-small interfering RNA (100 nM) reduce endogenous PAX2 protein. See Hueber et al. PAX2 inactivation enhances cisplatin-induced apoptosis in renal carcinoma cells, Kidney Int. 2006 Apr;69(7):1139-45 incorporated herein for its teaching of PAX2 antisense and PAX2 siRNA.
Additional inhibitors of PAX2 expression or the binding of PAX2 to the DEFB 1 promoter are provided to increase DEFB 1 expression in the presently disclosed methods.
For example, small molecules and antibodies are designed based on the present studies to interfere with or inhibit the binding of PAX2 to the DEFB1 promoter.
As shown herein, PAX2 inhibits expression of DEFB 1, and DEFB 1 is shown to have tumor cell killing activity. Thus, a method of treating cancer in a subject by administering DEFB1 is also provided. An example of a cancer treated by the present method is prostate cancer.
Similarly, provided is a method of treating cancer in a subject by increasing expression of DEFB1 in the subject. The present methods of administering or increasing the expression of DEFB1 are particularly effective for treatment of late stage prostate cancer.
In one embodiment of the methods of the invention for treating cancer by administering DEFB 1 or increasing DEFB 1 expression (e.g., by inhibiting expression or binding of PAX2), the subject is a subject diagnosed with prostate cancer. In a further embodiment of the methods of the invention for treating cancer by administering DEFB 1 or increasing DEFB 1 expression (e.g., by inhibiting expression or binding of PAX2), the subject is a subject diagnosed with advanced (late stage) prostate cancer.
In the method wherein the expression of DEFB 1 is increased, it can be increased by blocking the binding of PAX2 to the DEFB 1 promoter. The blocking of binding of PAX2 to the DEFB 1 promoter can be by administration of an oligonucleotide containing the PAX2 DNA binding site of DEFB 1. This oligonucleotide can be complementary to the sequence of PAX2 that binds to the DEFB 1 promoter. Alternatively, the oligonucleotide can interact with the PAX2 in a way that inhibits binding to DEFB 1. This interaction can be based on three-dimensional structure rather than primary nucleotide sequence.
PAX proteins are a family of transcription factors conserved during evolution and able to bind specific DNA sequences through a domains called a "paired domain"
and a "homeodomain". The paired domain (PD) is a consensus sequence shared by certain PAX
proteins (e.g., PAX2 and PAX6). The PD directs DNA binding of amino acids located in the a3-helix forming a DNA-Protein complex. For PAX2, the amino acids in the HD
recognize and interact specifically with a CCTTG DNA core sequence. Therefore, the critical region for PAX2 binding to DEFB 1 would be AAGTTCACCCTTGACTGTG.
Oligonucleotides up to and exceeding 64 bases in length, which include this sequence or its complement are expected to be inhibitors.
The DNA-binding specificity of the PAX-8 paired domain was investigated. Site selection experiments indicate that PAX-8 binds to a consensus sequence similar to those bound by PAX-2 and PAX-5. When consensus sequences of various paired domains are observed in light of recent structural studies describing paired-domain-DNA
interaction [Xu, Rould, Jun, Desplan and Pabo (1995) Cell 80, 639-650], it appears that base-pairs contacted in the minor groove are conserved, while most of the base-pairs contacted in the major groove are not. Therefore a network of specific minor groove contacts is a common characteristic of paired-domain-DNA interactions. The functional importance of such a network can be successfully tested by analyzing the effect of consensus-based mutations on the PAX2 binding site of the DEFB 1 promoter.
The PAX2 DNA binding site of DEFB 1 can comprise SEQ ID NO:1 (CCTTG).
The oligonucleotide comprising to the PAX2 DNA binding site of DEFB 1 is selected from the group consisting of Xl CCTTG (SEQ ID NO:1)X2, wherein Xl is from 1 to 35 contiguous flanking nucleotides of DEFB l and X2 is from 1 to 35 nucleotides. The nucleotides can be contiguous nucleotides that normally flank the PAX2 DNA binding site of DEFB
1.
Alternatively, they can be unrelated to DEFB 1, and selected routinely to avoid interference with the recognition sequence.
For example, the inhibitory oligonucleotides can be selected from the group consisting of:
CTCCCTTCAGTTCCGTCGAC (SEQ II) NO:9) CTCCCTTCACCTTGGTCGAC (SEQ ID NO:10) ACTGTGGCACCTCCCTTCAGTTCCGTCGACGAGGTTGTGC (SEQ ID NO: 12) ACTGTGGCACCTCCCTTCACCTTGGTCGACGAGGTTGTGC (SEQ ID NO: 13) The disclosed compositions can be used to treat any disease where uncontrolled cellular proliferation occurs such as cancers. A non-limiting list of different types of cancers is as follows: lymphomas (Hodgkins and non-Hodgkins), leukemias, carcinomas, carcinomas of solid tissues, squamous cell carcinomas, adenocarcinomas, sarcomas, gliomas, high grade gliomas, blastomas, neuroblastomas, plasmacytomas, histiocytomas, melanomas, adenomas, hypoxic tumors, myelomas, AIDS-related lymphomas or sarcomas, metastatic cancers, or cancers in general.
A representative but non-limiting list of cancers that the disclosed compositions can be used to treat is the following: lymphoma, B cell lymphoma, T cell lymphoma, mycosis fungoides, Hodgkin's Disease, myeloid leukemia, bladder cancer, brain cancer, nervous system cancer, head and neck cancer, squamous cell carcinoma of head and neck, kidney cancer, lung cancers such as small cell lung cancer and non-small cell lung cancer, neuroblastoma/glioblastoma, ovarian cancer, pancreatic cancer, prostate cancer, skin cancer, liver cancer, melanoma, squamous cell carcinomas of the mouth, throat, larynx, and lung, colon cancer, cervical cancer, cervical carcinoma, breast cancer, and epithelial cancer, renal cancer, genitourinary cancer, pulmonary cancer, esophageal carcinoma, head and neck carcinoma, large bowel cancer, hematopoietic cancers; testicular cancer; colon and rectal cancers, prostatic cancer, or pancreatic cancer. Compounds disclosed herein may also be used for the treatment of precancer conditions such as cervical and anal dysplasias, other dysplasias, severe dysplasias, hyperplasias, atypical hyperplasias, and neoplasias. Further, a number of diseases stemming from chronic inflammation, e.g., prostatitis and Benign Prostatic Hypertrophy (BPH), as well as various cancers of the prostate, can be impacted by the present methods and compounds.
DEFB 1's gene locus (8p23.3) is a hotspot for deletions and has been linked to patients with poorer prognosis. Thus, DEFB1 (and perhaps PAX2) can be used as a biomarker, e.g., in a screening for the early detection of prostate cancer.
Furthermore, data presented here indicate that its loss may occur as early as PIN (or even before), and may be ; a major contributing factor to the onset of prostate cancer.
Nucleic Acid Homology/Identity/Similarity It is understood that as discussed herein the use of the terms homology and identity mean the same thing as similarity. Thus, for example, if the use of the word homology is used between two non-natural sequences it is understood that this is not necessarily indicating an evolutionary relationship between these two sequences, but rather is looking at the similarity or relatedness between their nucleic acid sequences. Many of the methods for determining homology between two evolutionarily related molecules are routinely applied to any two or more nucleic acids or proteins for the purpose of measuring sequence similarity regardless of whether they are evolutionarily related or not.
In general, it is understood that one way to define any known variants and derivatives or those that might arise, of the disclosed genes and proteins herein, is through defining the variants and derivatives in terms of homology to specific known sequences.
This identity of particular sequences disclosed herein is also discussed elsewhere herein. In general, variants of genes and proteins herein disclosed typically have at least, about 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99 percent homology to the stated sequence or the native sequence. Those of skill in the art readily understand how to determine the homology of two proteins or nucleic acids, such as genes. For example, the homology can be calculated after aligning the two sequences so that the homology is at its highest level.
Another way of calculating homology can be performed by published algorithms.
Optimal alignment of sequences for comparison may be conducted by the local homology algorithm of Smith and Waterman Adv. Appl. Math. 2: 482 (1981), by the homology alignment algorithm of Needleman and Wunsch, J. MoL Biol. 48: 443 (1970), by the search for similarity method of Pearson and Lipman, Proc. Natl. Acad. Sci. U.S.A. 85:
(1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by inspection.
The same types of homology can be obtained for nucleic acids by for example the algorithms disclosed in Zuker, M. Science 244:48-52, 1989, Jaeger et al. Proc.
Natl. Acad.
Sci. USA 86:7706-7710, 1989, Jaeger et al.lVlethods Enzymol. 183:281-306, 1989 which are herein incorporated by reference for at least material related to nucleic acid alignment. It is understood that any of the methods typically can be used and that in certain instances the results of these various methods may differ, but the skilled artisan understands if identity is found with at least one of these methods, the sequences would be said to have the stated identity, and be disclosed herein.
For example, as used herein, a sequence recited as having a particular percent homology to another sequence refers to sequences that have the recited homology as calculated by any one or more of the calculation methods described above. For example, a first sequence has 80 percent homology, as defined herein, to a second sequence if the first sequence is calculated to have 80 percent homology to the second sequence using the Zuker calculation method even if the first sequence does not have 80 percent homology to the second sequence as calculated by., any of the other calculation methods. As another example, a first sequence has 80 percent homology, as defined herein, to a second sequence if the first sequence is calculated to have 80 percent homology to the second sequence using both the Zuker calculation method and the Pearson and Lipman calculation method even if the first sequence does not have 80 percent homology to the second sequence as calculated by the Smith and Waterman calculation method, the Needleman and Wunsch calculation method, the Jaeger calculation methods, or any of the other calculation methods. As yet another example, a first sequence has 80 percent homology, as defined herein, to a second sequence if the first sequence is calculated to have 80 percent homology to the second sequence using each of calculation methods (although, in practice, the different calculation methods will often result in different calculated homology percentages).
Hybridization/selective hybridization The term hybridization typically means a sequence driven interaction between at least two nucleic acid molecules, such as an oligonucleotide inhibitor, a primer or a probe and a gene. Sequence driven interaction means an interaction that occurs between two nucleotides or nucleotide analogs or nucleotide derivatives in a nucleotide specific manner.
For example, G interacting with C or A interacting with T are sequence driven interactions.
Typically sequence driven interactions occur on the Watson-Crick face or Hoogsteen face of the nucleotide. The hybridization of two nucleic acids is affected by a number of conditions and parameters known to those of skill in the art. For example, the salt concentrations, pH, and temperature of the reaction all affect whether two nucleic acid molecules will hybridize.
Parameters, for selective hybridization between two nucleic acid molecules are well known to those of skill in the art. For example, in some embodiments selective hybridization conditions can be defined as stringent hybridization conditions.
For example, stringency of hybridization is controlled by both temperature and salt concentration of either or both of the hybridization and washing steps. For example, the conditions of hybridization to achieve selective hybridization may involve hybridization in high ionic strength solution (6X SSC or 6X SSPE) at a temperature that is about 12-25 C
below the Tm (the melting temperature at which half of the molecules dissociate from their hybridization partners) followed by washing at a combination of temperature and salt concentration chosen so that the washing temperature is about 5 C to 20 C
below the Tm.
The temperature and salt conditions are readily determined empirically in preliminary experiments in which samples of reference DNA immobilized on filters are hybridized to a labeled nucleic acid of interest and then washed under conditions of different stringencies.
Hybridization temperatures are typically higher for DNA-RNA and RNA-RNA
hybridizations. The conditions can be used as described above to achieve stringency, or as is known in the art. (Sambrook et al., Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, New York, 1989; Kunkel et al.
Methods Enzymol. 1987:154:367, 1987 which is herein incorporated by reference for material at least related to hybridization of nucleic acids). A preferable stringent hybridization condition for a DNA:DNA hybridization can be at about 68 C (in aqueous solution) in 6X SSC or 6X SSPE followed by washing at 68 C. Stringency of hybridization and washing, if desired, can be reduced accordingly as the degree of complementarity desired is decreased, and further, depending upon the G-C or A-T richness of any area wherein variability is searched for. Likewise, stringency of hybridization and washing, if desired, can be increased accordingly as homology desired is increased, and further, depending upon the G-C or A-T richness of any area wherein high homology is desired, all as known in the art.
Another way to define selective hybridization is by lo,oking at the amount (percentage) of one of the nucleic acids bound to the other nucleic acid. For example, in some embodiments selective hybridization conditions would be when at least about, 60, 65, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97; 98, 99, 100 percent of the limiting nucleic acid is bound to the non-limiting nucleic acid. Typically, the non-limiting nucleic acid is in for example, 10 or 100 or 1000 fold excess. This type of assay can be performed at under conditions where both the limiting and non-limiting nucleic acid are for example, 10 fold or 100 fold or 1000 fold below their kd, or where only one of the nucleic acid molecules is 10 fold or 100 fold or 1000 fold or where one or both nucleic acid molecules are above their kd.
Another way to define selective hybridization is by looking at the percentage of nucleic acid that gets enzymatically manipulated under conditions where hybridization is required to promote the desired enzymatic manipulation, e.g., for primers. For example, in some embodiments selective hybridization conditions would be when at least about, 60, 65, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 percent of the primer is enzymatically manipulated under conditions which promote the enzymatic manipulation, for example if the enzymatic manipulation is DNA extension, then selective hybridization conditions would be when at least about 60, 65, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 percent of the primer molecules are extended.
Preferred conditions also include those suggested by the manufacturer or indicated in the art as being appropriate for the enzyme performing the manipulation.
Just as with homology, it is understood that there are a variety of methods herein disclosed for determining the level of hybridization between two nucleic acid molecules. It is understood that these methods and conditions may provide different percentages of hybridization between two nucleic acid molecules, but unless otherwise indicated meeting the parameters of any of the methods would be sufficient. For example if 80%
hybridization was required and as long as hybridization occurs within the required parameters in any one of these methods it is considered disclosed herein.
It is understood that those of skill in the art understand that if a composition or method meets any one of these criteria for determining.hybridization either collectively or singly it is a composition or method that is disclosed herein.
Nucleotides and related molecules A nucleotide is a molecule that contains a base moiety, a sugar moiety and a phosphate moiety.
Nucleotides can be linked together through their phosphate moieties and sugar moieties creating an internucleoside linkage. The base moiety of a nucleotide can be adenin-9-yl (A), cytosin-1-y,l (C), guanin-9-yl (G), uracil-1-yl (U); and thymin-1-yl (T). The sugar moiety of a nucleotide is a ribose or a deoxyribose. The phosphate moiety of a nucleotide is pentavalent phosphate. A
non-limiting example of a nucleotide would be 3'-AMP (3'-adenosine moriophosphate) or 5'-GMP (5'-guanosine monophosphate).
A nucleotide analog is a nucleotide which contains some type of modification to any of the base, sugar, or phosphate moieties. Modifications to the base moiety would include natural and synthetic modifications of A, C, G, and T/U as well as different purine or pyrimidine bases, such as uracil-5-yl (.psi.), hypoxanthin-9-yl (I), and 2-aminoadenin-9-yl.
A modified base includes but is not limited to 5-methylcytosine (5-me-C), 5-hydroxymethyl cytosine, xanthine, hypoxanthine, 2-aminoadenine, 6-methyl and other alkyl derivatives of adenine and guanine, 2-propyl and other alkyl derivatives of adenine and guanine, 2-thiouracil, 2-thiothymine and 2-thiocytosine, 5-halouracil and cytosine, 5-propynyl uracil and cytosine, 6-azo uracil, cytosine and thymine, 5-uracil (pseudouracil), 4-thiouracil, 8-halo, 8-amino, 8-thiol, 8-thioalkyl, 8-hydroxyl and other 8-substituted adenines and guanines, 5-halo particularly 5-bromo, 5-trifluoromethyl and other 5-substituted uracils and cytosines, 7-methylguanine and 7-methyladenine, 8-azaguanine and 8-azaadenine, 7-deazaguanine and 7-deazaadenine and 3-deazaguanine and 3-deazaadenine. Additional base modifications can be found for example in U.S. Pat. No. 3,687,808, Englisch et al., Angewandte Chemie, International Edition, 1991, 30, 613, and Sanghvi, Y. S., Chapter 15, Antisense Research and Applications, pages 289-302, Crooke, S. T. and Lebleu, B. ed., CRC Press, 1993. Certain nucleotide analogs, such as 5-substituted pyrimidines, 6-azapyrimidines and N-2, N-6 and 0-6 substituted purines, including 2-aminopropyladenine, 5-propynyluracil and 5-propynylcytosine. 5-methylcytosine can increase the stability of duplex formation. Often time base modifications can be combined with for example a sugar modification, such as 2'-O-methoxyethyl, to achieve unique properties such as increased duplex stability. There are numerous United States patents such as 4,845,205; 5,130,302; 5,134,066;
5,175,273;
5,367,066; 5,432,272; 5,457,187; 5,459,255; 5,484,908; 5,502,177; 5,525,711;
5,552,540;
5,587,469; 5,594,121, 5,596,091; 5,614,617; and 5,681,941, which detail and describe a range of base modifications. Each of these patents is herein incorporated by reference.
Nucleotide analogs can also include modifications of the sugar moiety.
Modifications to the sugar moiety would include natural modifications of the ribose and deoxyribose as well as synthetic modifications. Sugar modifications include but are not limited to the following modifications at the 2' position: OH; F; 0-, S-, or N-alkyl; 0-, S-, or N-alkenyl; 0-, S- or N-alkynyl; or O-alkyl-O-alkyl, wherein the alkyl, alkenyl and alkynyl may be substituted or unsubstituted Cl to Clo, alkyl or C2 to Clo alkenyl and alkynyl. 2' sugar modifications also include but are not limited to -O[(CH2)õ
O]m CH3, -O(CH2)r, OCH3, -O(CHa)õ NH2, -O(CH2)õ CH3, -O(CHa)n -ONH2, and -O(CHZ)õON[(CH2)õ
CH3)]2, where n and m are from 1 to about 10.
Other modifications at the 2' position include but are not lirnited to: Cl to Clo lower alkyl, substituted lower alkyl, alkaryl, aralkyl, 0-alkaryl or 0-aralkyl, SH, SCH3, OCN, Cl, Br, CN, CF3, OCF3, SOCH3, SOa CH3, ON02, NO2, N3, NH2, heterocycloalkyl, heterocycloalkaryl, aminoalkylamino, polyalkylamino, substituted silyl, an RNA
cleaving group, a reporter group, an intercalator, a group for improving the pharmacokinetic properties of an oligonucleotide, or a group for improving the pharmacodynamic properties of an oligonucleotide, and other substituents having similar properties.
Similar modifications may also be made at other positions on the sugar, particularly the 3' position of the sugar on the 3' terminal nucleotide or in 2'-5' linked oligonucleotides and the 5' position of 5' terminal nucleotide. Modified sugars would also include those that contain modifications at the bridging ring oxygen, such as CH2 and S. Nucleotide sugar analogs may also have sugar mimetics such as cyclobutyl moieties in place of the pentofuranosyl sugar. There are numerous United States patents that teach the preparation of such modified sugar structures such as 4,981,957; 5,118,800; 5,319,080; 5,359,044;
5,393,878; 5,446,137;
5,466,786; 5,514,785; 5,519,134; 5,567,811; 5,576,427; 5,591,722; 5,597,909;
5,610,300;
5,627,053; 5,639,873; 5,646,265; 5,658,873; 5,670,633; and 5,700,920, each of which is herein incorporated by reference in its entirety.
Nucleotide analogs can also be modified at the phosphate moiety. Modified phosphate moieties include but are not limited to those that can be modified so that the linkage between two nucleotides contains a phosphorothioate, chiral phosphorothioate, phosphorodithioate, phosphotriester, aminoalkylphosphotriester, methyl and other alkyl phosphonates including 3'-alkylene phosphonate and chiral phosphonates, phosphinates, phosphoramidates including 3'-amino phosphoramidate and aminoalkylphosphoramidates, thionophosphoramidates, thionoalkylphosphonates, thionoalkylphosphotriesters, and boranophosphates. It is understood that these phosphate or modified phosphate linkage between two nucleotides can be through a 3'-5' linkage or a 2'-5' linkage, and the linkage can contain inverted polarity such as 3'-5' to 5'-3' or 2'-5' to 5'-2'.
Various salts, mixed salts and free acid forms are also included. Numerous United States patents teach how to make and use nucleotides containing modified phosphates and include but are not limited to, 3,687,808; 4,469,863; 4,476,301; 5,023,243; 5,177,196; 5,188,897; 5,264,423;
5,276,019;
5,278,302; 5,286,717; 5,321,131; 5,399,676; 5,405,939; 5,453,496; 5,455,233;
5,466,677;
5,476,925; 5,519,126; 5,536,821; 5,541,306; 5,550,111; 5,563,253; 5,571,799;
5,587,361;
and 5,625,050, each of which is herein incorporated by reference. I
It is understood that nucleotide analogs need only contain a single modification, but may also contain multiple modifications within one of the moieties or between different moieties.
Nucleotide substitutes are molecules having similar functional properties to nucleotides, but which do not contain a phosphate moiety, such as peptide nucleic acid (PNA). Nucleotide substitutes are molecules that will recognize nucleic acids in a Watson-Crick or Hoogsteen manner, but which are linked together through a moiety other than a phosphate moiety. Nucleotide substitutes are able to conform to a double helix type structure when interacting with the appropriate target nucleic acid.
Nucleotide substitutes are nucleotides or nucleotide analogs that have had the phosphate moiety and/or sugar moieties replaced. Nucleotide substitutes do not contain a standard phosphorus atom. Substitutes for the phosphate can be for example, short chain alkyl or cycloalkyl intemucleoside linkages, mixed heteroatom and alkyl or cycloalkyl intemucleoside linkages, or one or more short chain heteroatomic or heterocyclic internucleoside linkages. These include those having morpholino linkages (formed in part from the sugar portion of a nucleoside); siloxane backbones; sulfide, sulfoxide and sulfone backbones;formacetyl and thioformacetyl backbones; methylene fozmacetyl and thioformacetyl backbones; alkene containing backbones; sulfamate backbones;
methyleneimino and inethylenehydrazino backbones; sulfonate and sulfonamide backbones;
amide backbones; and others having mixed N, 0, S and CH2 component parts.
Numerous United States patents disclose how to make and use these types of phosphate replacements and include but are not limited to 5,034,506; 5,166,315; 5,185,444; 5,214,134;
5,216,141;
5,235,033; 5,264,562; 5,264,564; 5,405,938; 5,434,257; 5,466,677; 5,470,967;
5,489,677;
5,541,307; 5,561,225; 5,596,086; 5,602,240; 5,610,289; 5,602,240; 5,608,046;
5,610,289;
5,618,704; 5,623,070; 5,663,312; 5,633,360; 5,677,437; and 5,677,439, each of which is herein incorporated by reference.
It is also understood in a nucleotide substitute that both the sugar and the phosphate moieties of the nucleotide can be replaced, by for example an amide type linkage (aminoethylglycine) (PNA). United States patents 5,539,082; 5,714,331;and 5,719,262 teach how to make and use PNA molecules, each of which is herein incorporated by reference. (See also Nielsen et al., Science, 1991, 254, 1497-1500).
It is also possible to link other types of molecules (conjugates) to nucleotides or nucleotide analogs to enhance for example, cellular uptake. Conjugates can be chemically linked to the nucleotide or nucleotide analogs. Such conjugates include but are not limited to lipid moieties such as a cholesterol moiety (Letsinger et al., Proc. Natl.
Acad. Sci. USA, 1989, 86, 6553-6556), cholic acid (Manoharan et al., Bioorg. Med. Chem. Let., 1994, 4, 1053-1060), a thioether, e.g., hexyl-S-tritylthiol (Manoharan et al., Ann.
N.Y. Acad. Sci., 1992, 660, 306-309; Manoharan et al., Bioorg. Med. Chem. Let., 1993, 3, 2765-2770), a thiocholesterol (Oberhauser et al., Nucl. Acids Res., 1992, 20, 533-538), an aliphatic chain, e.g., dodecandiol or undecyl residues (Saison-Behmoaras et al., EMBO J., 1991, 10, 1111-1118; Kabanov et al., FEBS Lett., 1990, 259, 327-330; Svinarchuk et al., Biochimie, 1993, 75, 49-54), a phospholipid, e.g., di-hexadecyl-rac-glycerol or triethylammonium 1,2-di-0-hexadecyl-rac-glycero-3-H-phosphonate (Manoharan et al., Tetrahedron Lett., 1995, 36, 3651-3654; Shea et al., Nucl. Acids Res., 1990, 18, 3777-3783), a polyamine or a polyethylene glycol chain (Manoharan et al., Nucleosides & Nucleotides, 1995, 14, 969-973), or adamantane acetic acid (Manoharan et al., Tetrahedron Left., 1995, 36, 3651-3654), a palxnityl moiety (Mishra et al., Biochim. Biophys. Acta, 1995, 1264, 229-237), or an octadecylamine or hexylamino-carbonyl-oxycholesterol moiety (Crooke et al., J. Pharmacol. Exp. Ther., 1996, 277, 923-937. Numerous United States patents teach the preparation of such conjugates and include, but are not limited to U.S.
Pat. Nos.
4,828,979; 4,948,882; 5,218,105; 5,525,465; 5,541,313; 5,545,730; 5,552,538;
5,578,717, 5,580,731; 5,580,731; 5,591,584; 5,109,124; 5,118,802; 5,138,045; 5,414,077;
5,486,603;
5,512,439; 5,578,718; 5,608,046; 4,587,044; 4,605,735; 4,667,025; 4,762,779;
4,789,737;
4,824,941; 4,835,263; 4,876,335; 4,904,582; 4,958,013; 5,082,830; 5,112,963;
5,214,136;
5,082,830; 5,112,963; 5,214,136; 5,245,022; 5,254,469; 5,258,506; 5,262,536;
5,272,250;
5,292,873; 5,317,098; 5,371,241, 5,391,723; 5,416,203, 5,451,463; 5,510,475;
5,512,667;
5,514,785; 5,565,552; 5,567,810; 5,574,142; 5,585,481; 5,587,371; 5,595,726;
5,597,696;
5,599,923; 5,599,928 and 5,688,941, each of which is herein incorporated by reference.
A Watson-Crick interaction is at least one interaction with the Watson-Crick face of a nucleotide, nucleotide analog, or nucleotide substitute. The Watson-Crick face of a nucleotide, nucleotide analog, or nucleotide substitute includes the C2, Nl, and C6 positions of a purine based nucleotide, nucleotide analog, or nucleotide substitute and the C2, N3, C4 positions of a pyrimidine based nucleotide, nucleotide analog, or nucleotide substitute.
A Hoogsteen interaction is the interaction that takes place on the Hoogsteen face of a nucleotide or nucleotide analog, which is exposed in the major groove of duplex DNA.
The Hoogsteen face includes the N7 position and reactive groups (NH2 or 0) at the C6 position of purine nucleotides.
Sequences There are a variety of sequences related to the DEFB 1 gene and to the PAX2 transcriptional factor, respectively, having the following GenBank Accession Numbers:
U50930 and NM 003989.1. These sequences and others are herein incorporated by reference in their entireties as well as for individual subsequences contained therein.
The one particular sequence set forth in SEQ ID NO: xxx and having GenBank accessioil number U50930 is used herein as an example to exemplify a source for the disclosed DEFB1 nucleic acids. The one particular sequence set forth in SEQ ID
NO:xxx and having GenBank accession number NM 003989 (see Appendix A).1 is used herein as an example, to exemplify a source for the disclosed PAX2 nucleic acids. Other examples of PAX2 sequences, based on alternative splicing are also found in GenBank. These are variants a-e, shown in Appendices B-F. It is understood that the description related to this sequence is applicable to any sequence related to unless specifically indicated otherwise.
Those of skill in the art understand how to resolve sequence discrepancies and differences and to adjust the compositions and methods relating to a particular sequence to other related sequences. siRNA molecules, competitive inhibitors of DEFBI promoter-PAX2, and primers and/or probes can be designed for any DEFB 1 or PAX2 sequence given the information disclosed herein and known in the art.
Nucleic acid synthesis The nucleic acids, such as, the oligonucleotides to be used as inhibitors can be made =
using standard chemical synthesis methods or can be produced using enzymatic methods or any other known method. Such methods can range from standard enzymatic digestion followed by nucleotide fragment isolation (see for example, Sambrook et al., Molecular Cloning: A Laboratory Manual, 2nd Edition (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989) Chapters 5, 6) to purely synthetic methods, for example, by the cyanoethyl phosphoramidite method using a Milligen or Beckman System 1PIus DNA
synthesizer (for example, Mode18700 automated synthesizer of.Milligen-Biosearch, Burlington, MA or ABI Mode1380B). Synthetic methods useful for making oligonucleotides are also described by Ikuta et al., Ann. Rev. Biochem. 53:323-356 (1984), (phosphotriester and phosphite-triester methods), and Narang et al., Methods Enzymol., 65:610-620 (1980), (phosphotriester method). Protein nucleic acid molecules can be made using known methods such as those described by Nielsen et al., Bioconjug.
Chem. 5:3-7 (1994).
Primers and probes Disclosed are compositions including primers and probes, which are capable of interacting with the DEFB 1 gene as disclosed herein. In certain embodiments the primers are used to support DNA amplification reactions. Typically the primers will be capable of being extended in a sequence specific manner. Extension of a primer in a sequence specific manner includes any methods wherein the sequence and/or composition of the nucleic acid molecule to which the primer is hybridized or otherwise associated directs or influences the composition or sequence of the product produced by the extension of the primer. Extension of the primer in a sequence specific manner therefore includes, but is not limited to, PCR, DNA sequencing, DNA extension, DNA polymerization, RNA transcription, or reverse transcription. Techniques and conditions that amplify the primer in a sequence specific manner are preferred. In certain embodiments the primers are used for the DNA
amplification reactions, such as PCR or direct sequencing. It is understood that in certain embodiments the primers can also be extended using non-enzymatic techniques, where for example, the nucleotides or oligonucleotides used to extend the primer are modified such that they will chemically react to extend the primer in a sequence specific manner.
The size of the primers or probes for interaction with the DEFB 1 or PAX2 gene in certain embodiments can be any size that supports the desired enzymatic manipulation of the priiner, such as DNA amplification or the simple hybridization of the probe or primer.
A typical primer or probe would be at least 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87 , 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450,475, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1250, 1500, 1750, 2000, 2250, 2500, 2750, 3000, 3500, or 4000 nucleotides long.
In other embodiments a primer or probe can be less than or equal to 6, 7, 8, 9, 10, 11, 12 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71; 72,73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1250, 1500, 1750, 2000, 2250, 2500, 2750, 3000, 3500, or 4000 nucleotides long.
The primers for the DEFB 1 or PAX2 gene typically will be used to produce an amplified DNA product that contains the region of the DEFB 1 gene to which PAX2 binds.
In general, typically the size of the product will be such that the size can be accurately determined to within 3, or 2 or 1 nucleotides.
In certain embodiments this product is at least 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1250, 1500, 1750, 2000, 2250, 2500, 2750, 3000, 3500, or 4000 nucleotides long.
In other embodiments the product is less than or equal to 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72; 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1250, 1500, 1750, 2000, 2250, 2500, 2750, 3000, 3500, or 4000 nucleotides long.
Functional Nucleic Acids RNAi It is also understood that the disclosed nucleic acids can be used for RNAi or RNA
interference. It is thought that RNAi involves a two-step mechanism for RNA
interference (RNAi): an initiation step and an effector step. For example, in the first step, input double-stranded (ds) RNA (siRNA) is processed into small fragments, such as 21-23-nucleotide 'guide sequences'. RNA amplification occurs in whole animals. Typically then, the guide RNAs can be incorporated into a protein RNA complex which is capable of degrading RNA, the nuclease complex, which has been called the RNA-induced silencing complex (RISC). This RISC complex acts in the second effector step to destroy mRNAs that are recognized by the guide RNAs through base-pairing interactions. RNAi involves the introduction by any means of double stranded RNA into the cell which triggers events that cause the degradation of a target RNA. RNAi is a form of post-transcriptional gene silencing. In addition to the siRNAs disclosed herein, disclosed are RNA
hairpins that can act in RNAi. For description of making and using RNAi molecules see, e.g., Hammond et al., Nature Rev Gen 2: 110-119 (2001); Sharp, Genes Dev 15: 485-490 (2001), Waterhouse et al., Proc. Natl. Acad. Sci. USA 95(23): 13959-13964 (1998) all of which are incorporated herein by reference in their entireties and at least form material related to delivery and making of RNAi molecules.
RNAi has been shown to work in many types of cells, including mammalian cells.
For work in mammalian cells it is preferred that the RNA molecules which will be used as targeting sequences within the RISC complex are shorter. For example, less than or equal to 50 or 40 or 30 or 29, 28, 27, 26, 25, 24, 23,,22, 21, 20, 19, 18, 17, 16, 15, 14, 13 , 12, 11, or 10 nucleotides in length. These RNA molecules can also have overhangs on the 3' or 5' ends relative to the target RNA wh.ich is to be cleaved. These overhangs can be at least or less than or equal to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, or 20 nucleotides long. RNAi works in mammalian stem cells, such as mouse ES cells. Examples of siRNAs can be found in Table 4.
Functional nucleic acids are nucleic acid molecules that have a specific function, such as binding a target molecule or catalyzing a specific reaction.
Functional nucleic acid molecules can be divided into the following categories, which are not meant to be limiting.
For example, functional nucleic acids include antisense molecules, aptamers, ribozymes, triplex forming molecules, and external guide sequences. The functional nucleic acid molecules can act as effectors, inhibitors, modulators, and stimulators of a specific activity possessed by a target molecule, or the functional nucleic acid molecules can possess a de novo activity independent of any other molecules.
Functional nucleic acid molecules can interact with any macromolecule, such as DNA, RNA, polypeptides, or carbohydrate chains. Thus, functional nucleic acids can interact with mRNA or the genomic DNA of PAX2. Often functional nucleic acids are designed to interact with other nucleic acids based on sequence homology between the target molecule and the functional nucleic acid molecule: In other situations, the specific recognition between the functional nucleic acid molecule and the target molecule is not based on sequence homology between the functional nucleic acid molecule and the target molecule, but rather is based on the formation of tertiary structure that allows specific recognition to take place.
Antisense molecules are designed to interact with a target nucleic acid molecule through either canonical or non-canonical base pairing. The interaction of the antisense molecule and the target molecule is designed to promote the destruction of the target molecule through, for example, RNAseH mediated RNA-DNA hybrid degradation.
Alternatively the antisense molecule is designed to interrupt a processing function that normally woulda take place on the target molecule, such as transcription or replication.
Antisense molecules can be designed based on the sequence of the target molecule.
Numerous methods for optimization of antisense efficiency by finding the most accessible regions of the target molecule exist. Exemplary methods would be in vitro selection experiments and DNA modification studies using DMS and DEPC. It is preferred that antisense molecules bind the target molecule with a dissociation constant (ka)less than or equal to 10-6,10-$, 10"10, or 10-12. A representative sample of methods and techniques which aid in the design and use of antisense molecules can be found in the following non-limiting list of United States patents: 5,135,917, 5,294,533, 5,627,158, 5,641,754, 5,691,317, 5,780,607, 5,786,138, 5,849,903, 5,856,103, 5,919,772, 5,955,590, 5,990,088, 5,994,320, 5,998,602, 6,005,095, 6,007,995, 6,013,522, 6,017,898, 6,018,042, 6,025,198, 6,033,910, 6,040,296, 6,046,004, 6,046,319, and 6,057,437.
Aptaniers are molecules that interact with a target molecule, preferably in a specific way. Typically aptamers are small nucleic acids ranging from 15-50 bases in lengtli that fold into defined secondary and tertiary structures, such as stem-loops or G-quartets.
Aptamers can bind small molecules, such as ATP (United States patent 5,631,146) and theophiline (United States patent 5,580,737), as well as large molecules, such as reverse transcriptase (United States patent 5,786,462) and thrombin (United States patent 5,543,293). Aptamers can bind very tightly with kds from the target molecule of less than 10-12 M. It is preferred that the aptamers bind the target molecule with a kd less than 10"6, 10, 100, or 10-12. Aptamers can bind the target molecule with a very high degree of specificity. For example, aptamers have been isolated that have greater than a 10000 fold difference in binding affinities between the target molecule and another molecule that differ at only a single position on the molecule (United States patent 5,543,293). It is preferred that the aptamer have a kd with the target molecule at ieast 10, 100, 1000, 10,000, or 100,000 fold lower than the ka with a background binding molecule.
Representative examples of how to make and use aptamers to bind a variety of different target molecules can be found in the following non-limiting list of United States patents:
5,476,766, 5,503,978, 5,631,146, 5,731,424, 5,780,228, 5,792,613, 5,795,721, 5,846,713, 5,858,660, 5,861,254, 5,864,026, 5,869,641, 5,958,691, 6,001,988, 6,011,020, 6,013,443, 6,020,130, 6,028,186, 6,030,776, and 6,051,698.
Ribozymes are nucleic acid molecules that are capable of catalyzing a chemical reaction, either intramolecularly or intermolecularly. Ribozymes are thus catalytic nucleic acid. It is preferred that the ribozymes catalyze intermolecular reactions.
There are a number of different types of ribozymes that catalyze nuclease or nucleic acid polymerase type reactions which are based on ribozymes found in natural systems, such as hammerhead ribozymes, (for example, but not limited to the following United States patents: 5,334,711, 5,436,330, 5,616,466, 5,633,133, 5,646,020, 5,652,094, 5,712,384, 5,770,715, 5,856,463, 5,861,288, 5,891,683, 5,891,684, 5,985,621, 5,989,908, 5,998,193, 5,998,203, by Ludwig and Sproat, WO 9858057 by Ludwig and Sproat, and WO 9718312 by Ludwig and Sproat) hairpin ribozymes (for example, but not limited to the following United States patents: 5,631,115, 5,646,031, 5,683,902, 5,712,384, 5,856,188, 5,866,701, 5,869,339, and 6,022,962), and tetrahymena ribozymes (for example, but not limited to the following -United States patents: 5,595,873 and 5,652,107). There are also a number of ribozymes that are not found in natural systems, but which have been engineered to catalyze specific reactions de novo (for example, but not limited to the following United States patents:
5,580,967, 5,688,670, 5,807,718, and 5,910,408). Preferred ribozymes cleave RNA or DNA substrates, and more preferably cleave RNA substrates. Ribozymes typically cleave nucleic acid substrates through recognition and binding of the target substrate with subsequent cleavage. This recognition is often based mostly on canonical or non-canonical base pair interactions. This property makes ribozymes particularly good candidates for target specific cleavage of nucleic acids because recognition of the target substrate is based on the target substrates sequence.' Representative,examples of how to make and use ribozymes to catalyze a variety of different reactions can be found in the following non-limiting list of United States patents: 5,646,042, 5,693,535, 5,731,295, 5,811,300, 5,837,855, 5,869,253, 5,877,021, 5,877,022, 5,972,699, 5,972,704, 5,989,906, and 6,017,756.
Triplex forming functional nucleic acid molecules are molecules that can interact with either double-stranded or single-stranded nucleic acid. When triplex molecules interact with a target region, a structure called a triplex is formed, in which there three strands of DNA are forming a complex dependant on both Watson-Crick and Hoogsteen base-pairing. Triplex molecules are preferred because they can bind target regions with high affinity and specificity. It is preferred that the triplex forming molecules bind the target molecule with a kd less than 10"6, 10-8, 10"10, or 10"12 .
Representative examples of how to make and use triplex fonning molecules to bind a variety of different target molecules can be found in the following non-limiting list of United States patents:
5,176,996, 5,645,985, 5,650,316, 5,683,874, 5,693,773, 5,834,185, 5,869,246, 5,874,566, and 5,962,426.
External guide sequences (EGSs) are molecules that bind a target nucleic acid molecule forming a complex, and this complex is recognized by. RNase P, which cleaves the target molecule. EGSs can be designed to specifically target a RNA molecule of choice.
RNAse P aids in processing transfer RNA (tRNA) within a cell. Bacterial RNAse P can be recruited to cleave virtually any RNA sequence by using an EGS that causes the target RNA:EGS complex to mimic the natural tRNA substrate. (WO 92/03566 by Yale, and Forster and Altman, Science 238:407-409 (1990)).
Similarly, eukaryotic EGS/RNAse P-directed cleavage of RNA can be utilized to cleave desired targets within eukaryotic cells. (Yuan et al., Proc. Natl.
Acad. Sci. USA
89:8006-8010 (1992); WO 93/22434 by Yale; WO 95/24489 by Yale; Yuan and Altman, EMBO J 14:159-168 (1995), and Carrara et al., Proc. Natl. Acad. Sci. (USA) 92:2627-2631 (1995)). Representative examples of how to make and use EGS molecules to facilitate cleavage of a variety of different target molecules be found in the following non-limiting list of United States patents: 5,168,053, 5,624,824, 5,683,873, 5,728,521, 5,869,248, and 5,877,162.
Delivery of the compositions to cells There are a number of compositions and methods which can be used to deliver nucleic acids to cells, either in vitro or in vivo. These methods and compositions can largely be broken down into two classes: viral based delivery systems and non-viral based delivery systems. For example, the nucleic acids can be delivered through a number of direct delivery systems such as, electroporation, lipofection, calcium phosphate precipitation, plasmids, viral vectors, viral nucleic acids, phage nucleic acids, phages, cosmids, or via transfer of genetic material in cells or carriers such as cationic liposomes.
Appropriate means for transfection, including viral vectors, chemical transfectants, or physico-mechanical methods such as electroporation and direct diffusion of DNA, are described by, for example, Wolff, J. A., et al., Science, 247, 1465-1468, (1990); and Wolff, J. A. Nature, 352, 815-818, (1991)Such methods are well known in the art and readily adaptable for use with the compositions and methods described herein. In certain cases, the methods will be modified to specifically function with large DNA molecules.
Further, these methods can be used to target certain diseases and cell populations by using the targeting characteristics of the carrier.
Nucleic acid based delivery systems Transfer vectors can be any nucleotide construction used to deliver genes into cells (e.g., a plasmid), or as part of a general strategy to deliver genes, e.g., as part of recombinant retrovirus or adenovirus (Ram et al. Cancer Res. 53:83-88, (1993)).
As used herein, plasmid or viral vectors are agents that transport the disclosed nucleic acids, such as DEFBl coding sequences, PAX2 siRNAs or other antisense molecules into the cell without degradation and include a promoter yielding expression of the gene in the cells into which it is delivered. Viral vectors are, for example, Adenovirus, Adeno-associated virus, Herpes virus, Vaccinia virus, Polio virus, AIDS virus, neuronal trophic virus, Sindbis and other RNA viruses, including these viruses with the HIV
backbone. Also preferred are any viral families which share the properties of these viruses which make them suitable for use as vectors. Retroviruses include Murine Maloney Leukemia virus, MMLV, and retroviruses that express the desirable properties of MMLV as a vector. Retroviral vectors are able to carry a larger genetic payload, i.e., a transgene or marker gene, than other viral vectors, and for this reason are a commonly used vector.
However, they are not as useful in non-proliferating cells. Adenovirus vectors are relatively stable and easy to work with, have high titers, and can be delivered in aerosol formulation, and can transfect non-dividing cells. Pox viral vectors are large and have several sites for inserting genes, they are thermostable and can be stored at room temperature.
A preferred embodiment is.a viral vector which has been engineered so as to suppress the immune response of the host organism, elicited by the viral antigens. Preferred vectors of this type will carry coding regions for Interleukin 8 or 10.
Viral vectors can have higher transaction (ability to introduce genes) abilities than chemical or physical methods to introduce genes into cells. Typically, viral vectors contain, nonstructural early genes, structural late genes, an RNA polymerase III
transcript, inverted terminal repeats necessary for replication and encapsidation, and promoters to control the transcription and replication of the viral genome. When engineered as vectors, viruses typically have one or more of the early genes removed and a gene or gene/promotor cassette is inserted into the viral genome in place of the removed viral DNA.
Constructs of this type can carry up to about 8 kb of foreign genetic material. The necessary functions of the removed early genes are typically supplied by cell lines which have been engineered to express the gene products of the early genes in trans.
Retroviral Vectors A retrovirus is an animal virus belonging to the virus family of Retroviridae, including any types, subfamilies, genus, or tropisms. Retroviral vectors, in general, are described by Verma, I.M., Retroviral vectors for gene transfer. In Microbiology-1985, American Society for Microbiology, pp. 229-232, Washington, (1985), which is incorporated by reference herein. Examples of methods for using retroviral vectors for gene therapy are described in U.S. Patent Nos. 4,868,116 and 4,980,286; PCT
applications WO
90/02806 and WO 89/07136; and Mulligan, (Science 260:926-932 (1993)); the teachings of which are incorporated herein by reference.
A retrovirus is essentially a package which has packed into it nucleic acid cargo.
The nucleic acid cargo carries with it a packaging signal, which ensures that the replicated daughter molecules will be efficiently packaged within the package coat. In addition to the package signal, there are a number of molecules which are needed in cis, for the replication, and packaging of the replicated virus. Typically a retroviral genome, contains the gag, pol, and env genes which are involved in the making of the protein coat. It is the gag, pol, and env genes which are typically replaced by the foreign DNA that it is to be transferred to the target cell. Retrovirus vectors typically contain a packaging signal for incorporation into the package coat, a sequence which signals the start of the gag transcription unit, elements necessary for reverse transcription, including a primer binding site to bind the tRNA primer of reverse transcription, terminal repeat sequences that guide the switch of RNA strands during DNA synthesis, a purine rich sequence 5' to the 3' LTR that serve as the priming site for the synthesis of the second strand of DNA synthesis, and specific sequences near the ends of the LTRs that enable the insertion of the DNA state of the retrovirus to insert into the host genome. The removal of the gag, pol, and env genes allows for about 8 kb of foreign sequence to be inserted into the viral genome, become reverse transcribed, and upon replication be packaged into a new retroviral particle. This amount of nucleic acid is sufficient for the delivery of a one to many genes depending on the size of each transcript.
It is preferable to include either positive or negative selectable markers along with other genes in the insert.
Since the replication machinery and packaging proteins in most retroviral vectors have been removed (gag, pol, and env), the vectors are typically generated by placing them into a packaging cell line. A packaging cell line is a cell line which has been transfected or transformed with a retrovirus that contains the replication and packaging machinery, but lacks any packaging signal. When the vector carrying the DNA of choice is transfected into these cell lines, the vector containing the gene of interest is replicated and packaged into new retroviral particles, by the machinery provided in cis by the helper cell.
The genomes for the machinery are not packaged because they lack the necessary signals.
Adenoviral Vectors The construction of replication-defective adenoviruses has been described (Berkner et al., J. Virology 61:1213-1220 (1987); Massie et al., Mol. Cell. Biol.
6:2872-2883 (1986); Haj-Ahmad et al., J. Virology 57:267-274 (1986); Davidson et al., J.
Virology 61:1226-1239 (1987); Zhang "Generation and identification of recombinant adenovirus by liposome-mediated transfection and PCR analysis" BioTechniques 15:868-872 (1993)).
The benefit of the use of these viruses as vectors is that they are limited in the extent to which they can spread to other cell types, since they can replicate within an initial infected cell, but are unable to form new infectious viral particles. Recombinant adenoviruses have been shown to achieve high efficiency gene transfer after direct, in vivo delivery to airway epithelium, hepatocytes, vascular endothelium, CNS parenchyma and a number of other tissue sites (Morsy, J. Clin. Invest. 92:1580-1586 (1993); Kirshenbaum, J.
Clin. Invest.
92:381-387 (1993); Roessler, J. Clin. Invest. 92:1085-1092 (1993); Moullier, Nature Genetics 4:154-159 (1993); La Salle, Science 259:988-990 (1993); Gomez-Foix, J. Biol.
Chem. 267:25129-25134 (1992); Rich, Human Gene Therapy 4:461-476 (1993);
Zabner, Nature Genetics 6:75-83 (1994); Guzman, Circulation Research 73:1201-1207 (1993);
Bout, Human Gene Therapy 5:3-10 (1994); Zabner, Cell 75:207-216 (1993);
Caillaud, Eur. J. Neuroscience 5:1287-1291(1993); and Ragot, J. Gen. Virology 74:501-507 (1993)).
Recombinant adenoviruses achieve gene transduction by binding to specific cell surface receptors, after which the virus is internalized by, receptor-mediated endocytosis, in the same manner as wild type or replication-defective adenovirus (Chardonnet and Dales, Virology 40:462-477 (1970); Brown and Burling.ham, J. Virology 12:386-396 (1973);
Svensson and Persson, J. Virology 55:442-449 (1985); Seth, et al., J. Virol.
51:650-655 (1984); Seth, et al., Mol. Cell. Biol. 4:1528-1533 (1984); Varga et al., J.
Virology 65:6061-6070 (1991); Wickham et al., Cell 73:309-319 (1993)).
A viral vector can be one based on an adenovirus which has had the El gene removed and these virions are generated in a cell line such as the human 293 cell line. In another preferred embodiment both the El and E3 genes are removed from the adenovirus genome.
Adeno-associated viral vectors Another type of viral vector is based on an adeno-associated virus (AAV). This defective parvovirus is a preferred vector because it can infect many cell types and is nonpathogenic to humans. AAV type vectors can transport about 4 to 5 kb and wild type AAV is known to stably insert into chromosome 19. Vectors which contain this site specific integration property are preferred. An especially preferred embodiment of this type of vector is the P4.1 C vector produced by Avigen, San Francisco, CA, which can contain the herpes simplex virus thymidine kinase gene, HSV-tk, and/or a marker gene, such as the gene encoding the green fluorescent protein, GFP.
In another type of AAV virus, the AAV contains a pair of inverted terminal repeats (ITRs) which flank at least one cassette containing a promoter which directs cell-specific expression operably linked to a heterologous gene. Heterologous in this context refers to any nucleotide sequence or gene which is not native to the AAV or B 19 parvovirus.
Typically the AAV and B 19 coding regions have been deleted, resulting in a safe, noncytotoxic vector. The AAV ITRs, or modifications thereof, confer infectivity and site-specific integration, but not cytotoxicity, and the promoter directs cell-specific expression.
United states Patent No. 6,261,834 is herein incorporated by reference for material related to the AAV vector.
1. The disclosed vectors thus provide DNA molecules which are capable of integration into a mammalian chromosome without substantial toxicity.
2. The inserted genes in viral and retroviral usually contain promoters, and/or enhancers to,help control the expression of the desired gene product. A
promoter is generally a sequence or sequences of DNA that function when in a relatively fixed location in regard to the transcription startsite. A promoter contains core elements required for basic interaction of RNA polymerase and transcription factors, and may contain upstream elements and response elements.
Large payload viral vectors Molecular genetic experiments with large human herpes viruses have provided a means whereby large heterologous DNA fragments can be cloned, propagated and established in cells permissive for infection with herpes viruses (Sun et al., Nature genetics 8: 33-41, 1994; Cotter and Robertson, Curr Opin Mol Ther 5: 633-644, 1999).
These large DNA viruses (herpes simplex virus (HSV) and Epstein-Barr virus (EBV), have the potential to deliver fragments of human heterologous DNA > 150 kb to specific cells. EBV
recombinants can maintain large pieces of DNA in the infected B-cells as episomal DNA.
Individual clones carried human genomic inserts up to 330 kb appeared genetically stable The maintenance of these episomes requires a specific EBV nuclear protein, EBNAl, constitutively expressed during infection with EBV. Additionally, these vectors can be used for transfection, where large amounts of protein can be generated transiently in vitro.
Herpesvirus amplicon systems are also being used to package pieces of DNA >
220 kb and to infect cells that can stably maintain DNA as episomes.
Other useful systems include, for example, replicating and host-restricted non-replicating vaccinia virus vectors.
Non-nucleic acid based systems The disclosed compositions can be delivered to the target cells in a variety of ways.
For example, the compositions can be delivered through electroporation, or through lipofection, or through calcium phosphate precipitation. The delivery mechanism chosen will depend in part on the type of cell targeted and whether the delivery is occurring for example in vivo or in vitro.
Thus, the compositions can comprise, in addition to the disclosed vectors for example, lipids such as liposomes, such as cationic liposomes (e.g., DOTMA, DOPE, and DC-cholesterol) or anionic liposomes. Liposomes can fi.u-ther comprise proteins to facilitate targeting a particular cell, if desired. Administration of a composition comprising a compound and a cationic liposome can be administered to the blood afferent to a target organ or inhaled into the respiratory tract to target cells of the respiratory tract. Regarding liposomes, see, e.g., Brigham et al. Am. J. Resp. Cell. Mol. Biol. -1:95-100 (1989); Felgner et al. Proc. Natl. Acad. Sci USA 84:7413-7417 (1987); U.S. Pat. No.4,897,355.
Furthermore, the compound can be administered as a component of a microcapsule that can be targeted to specific cell types, such as macrophages, or where the diffusion of the compound or delivery of the compound from the microcapsule is designed for a specific rate or dosage.
In the methods described above which include the administration and uptake of exogenous DNA into the cells of a subject (i.e., gene transduction or transfection), delivery of the compositions to cells can be via a variety of mechanisms. As one example, delivery can be via a liposome, using commercially available liposome preparations such as LIPOFECTIN, LIPOFECTAMINE (GIBCO-BRL, Inc., Gaithersburg, MD), SUPERFECT
(Qiagen, Inc. Hilden, Germany) and TRANSFECTAM (Promega Biotec, Inc., Madison, WI), as well as other liposomes developed according to procedures standard in the art. In addition, the disclosed nucleic acid or vector can be delivered in vivo by electroporation, the technology for which is available from Genetronics, Inc. (San Diego, CA) as well as by means of a SONOPORATION machine (ImaRx Pharmaceutical Corp., Tucson, AZ).
The materials may be in solution, suspension (for example, incorporated into microparticles, liposomes, or cells). These may be targeted to a particular cell type via antibodies, receptors, or receptor ligands. The following references are examples of the use of this technology to target specific proteins to tumor tissue (Senter, et al., Bioconiugate Chem., 2:447-451, (1991); Bagshawe, K.D., Br. J. Cancer, 60:275-281, (1989);
Bagshawe, et al., Br. J. Cancer, 58:700-703, (1988); Senter, et al., Bioconjugate Chem., 4:3-9, (1993);
Battelli, et al., Cancer Immunol. Immunother., 35:421-425, (1992); Pietersz and McKenzie, Immunolog. Reviews, 129:57-80, (1992); and Roffler, et al., Biochem.
Pharmacol, 42:2062-2065, (1991)). These techniques can be used for a variety of other specific cell types. Vehicles such as "stealth" and other antibody conjugated liposomes (including lipid mediated drug targeting to colonic carcinoma), receptor mediated targeting of DNA through cell specific ligands, lymphocyte directed tumor targeting, and highly specific therapeutic retroviral targeting of murine glioma cells in vivo. The following references are examples of the use of this technology to target specific proteins to tumor tissue (Hughes et al., Cancer Research, 49:6214-6220, (1989); and Litzinger and Huang, Biochimica et Biophysica Acta, 1104:179-187, (1992)). In general,-receptors are involved in pathways of endocytosis, either constitutive or ligand induced. These receptors cluster in clathrin-coated pits, enter the cell via clathrin-coated vesicles, pass through an acidified endosome in which the receptors are sorted, and then either recycle to the cell surface, become stored intracellular, or are degraded in lysosomes. The internalization pathways serve a variety of functions, such as nutrient uptake, removal of activated proteins, clearance of macromolecules, opportunistic entry of viruses and toxins, dissociation and degradation of ligand, and receptor-level regulation. Many receptors follow more than one intracellular pathway, depending on the cell type, receptor concentration, type of ligand, ligand valency, and ligand concentration. Molecular and'cellular mechanisms of receptor-mediated endocytosis has been reviewed (Brown and Greene, DNA and Cell Biology 10:6, (1991)).
Nucleic acids that are delivered to cells which are to be integrated into the host cell genome, typically contain integration sequences. These sequences are often viral related sequences, particularly when viral based systems are used. These viral integration systems can also be incorporated into nucleic acids which are to be delivered using a non-nucleic acid based system of deliver, such as a liposome, so that the nucleic acid contained in the delivery system can be come integrated into the host genome.
Other general techniques for integration into the host genome include, for example, systems designed to promote homologous recombination with the host genome.
These systems typically rely on sequence flanking the nucleic acid to be expressed that has enough homology with a target sequence within the host cell genome that recombination between the vector nucleic acid and the target nucleic acid takes place, causing the delivered nucleic acid to be integrated into the host genome. These systems and the methods necessary to promote homologous recombination are known to those of skill in the art.
In vivo/ex vivo As described herein, the compositions can be administered in a pharmaceutically acceptable carrier and can be delivered to the subject's cells in vivo and/or ex vivo by a variety of mechanisms well known in the art (e.g., uptake of naked DNA, liposome fusion, intramuscular-injection of DNA via a gene gun, endocytosis and the like).
If ex vivo methods are employed, cells or tissues can be removed and maintained outside the body according to standard protocols well known in the art. The compositions can be introduced into the cells via any gene transfer mechanism, such as, for example, calcium phosphate mediated gene delivery, electroporation, microinjection or proteoliposomes. The transduced cells can then be infused (e.g., in a pharmaceutically acceptable carrier) or homotopically transplanted back into the subject per standard methods for the cell or tissue type. Standard methods are known for transplantation or infusion of various cells into a subject.
Expression systems The nucleic acids that are delivered to cells typically contain expression controlling systems. For example, the inserted genes in viral and retroviral systems usually contain promoters, and/or enhancers to help control the expression of the desired gene product. A
promoter is generally a sequence or sequences of DNA that function when in a relatively fixed location in regard to the transcription start site. A promoter contains core elements required for basic interaction of RNA polymerase and transcription factors, and may contain upstream elements and response elements.
Viral Promoters and Enhancers Preferred promoters controlling transcription from vectors in mammalian host cells may be obtained from various sources, for example, the genomes of viruses such as:
polyoma, Simian Virus 40 (SV40), adenovirus, retroviruses, hepatitis-B virus and most preferably cytomegalovirus, or from heterologous mammalian promoters, e.g.
beta actin promoter. The early and late promoters of the SV40 virus are conveniently obtained as an SV40 restriction fragment which also contains the SV40 viral origin of replication (Fiers et al., Nature, 273: 113 (1978)). The immediate early promoter of the human cytomegalovirus is conveniently obtained as a HindIII E restriction fragment (Greenway, P.J. et al., Gene 18: 355-360 (1982)). Of course, promoters from the host cell or related species also are useful herein.
Enhancer generally refers to a sequence of DNA that functions at no fixed distance from the transcription start site and can be either 5' (Laimins, L. et al., Proc. Nati. Acad.
Sci. 78: 993 (1981)) or 3' (Lusky, M.L., et al., Mol. Cell Bio. 3: 1108 (1983)) to the transcription unit. Furthermore, enhancers can be within an intron (Banerji, J.L. et al., Cell 33: 729 (1983)) as well as within the coding sequence itself (Osborne, T.F., et al., Mol. Cell Bio: 4: 1293 (1984)). They are usually between 10 and 300 bp in length, and they function;
in cis. Enhancers function to increase transcription from nearby promoters.
Enhancers also often contain response elements that mediate the regulation of transcription.
Promoters can also contain response elements that mediate the regulation of transcription.
Enhancers often determine the regulation of expression of a gene. While many enhancer sequences are now known from mammalian genes (globin, elastase, albumin, -fetoprotein and insulin), typically one will use an enhancer from a eukaryotic cell virus for general expression.
Preferred examples are the SV40 enhancer on the late side of the replication origin (bp 100-270), the cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers.
The promotor and/or enhancer may be specifically activated either by light or specific chemical events which trigger their fun.ction. Systems can be regulated by reagents such as tetracycline and dexamethasone. There are also ways to enhance viral vector gene expression by exposure to irradiation, such as gamma irradiation, or alkylating chemotherapy drugs.
In certain embodiments the promoter and/or enhancer region can act as a constitutive promoter and/or enhancer to maximize expression of the region of the transcription unit to be transcribed. In certain constructs the promoter and/or enhancer region be active in all eukaryotic cell types, even if it is only expressed in a particular type of cell at a particular time. A preferred promoter of this type is the CMV
promoter (650 bases). Other preferred promoters are SV40 promoters, cytomegalovirus (full length promoter), and retroviral vector LTR.
It has been shown that all specific regulatory elements can be cloned and used to construct expression vectors that are selectively expressed in specific cell types such as melanoma cells. The glial fibrillary acetic. protein (GFAP) promoter has been used to selectively express genes in cells of glial origin.
Expression vectors used in eukaryotic host cells (yeast, fungi, insect, plant, animal, human or nucleated cells) may also contain sequences necessary for the termination of transcription which may affect mRNA expression. These regions are transcribed as polyadenylated segments in the untranslated portion of the mRNA encoding tissue factor protein. The 3' untranslated regions also include transcription termination sites. It is preferred that the transcription unit also contain a polyadenylation region.
One benefit of this region is that it increases the likelihood that the transcribed unit will be processed and transported like mRNA. The identification and use of polyadenylation signals in expression constructs is well established. It is preferred that homologous polyadenylation signals be used in the transgene constructs. In certain transcription units, the polyadenylation region is derived from the SV40 early polyadenylation signal and consists of about 400 bases. It is also preferred that the transcribed units contain other standard sequences alone or in combination with the above sequences improve expression from, or stability of, the construct.
Proteins Protein variants Variants of the DEFB1 protein are provided. Derivatives of the DEFBI protein function in the disclosed methods and compositions. Protein variants and derivatives are well understood to those of skill in the art and in can involve amino acid sequence modifications. For example, amino acid sequence modifications typically fall into one or more of three classes: substitutional, insertional or deletional variants.
Insertions include amino and/or carboxyl terminal fusions as well as intrasequence insertions of single or multiple amino acid residues. Insertions ordinarily will be smaller insertions than those of ainino or carboxyl terminal fusions, for example, on the order of one to four residues.
Immunogenic fusion protein derivatives, such as those described in the examples, are made by fusing a polypeptide sufficiently large to confer immunogenicity to the target sequence by cross-linking in vitro or by recombinant cell culture transformed with DNA
encoding the fusion. Deletions are characterized by the removal of one or more amino acid residues from the protein sequence. Typically, no more than about from 2 to 6 residues are deleted at any one site within the protein molecule. These variants ordinarily are prepared by site specific mutagenesis of nucleotides in the DNA encoding the protein, thereby producing DNA
encoding the variant, and thereafter expressing the DNA in recombinant cell culture.
Techniques for making substitution mutations at predetermined sites in DNA
having a known sequence are well known, for example M13 primer mutagenesis and PCR
mutagenesis. Amino acid substitutions are typically of single residues, but can occur at a number of different locations at once; insertions usually will be on the order of about from 1 to 10 amino acid residues; and deletions will range about from I to 30 residues. Deletions or insertions preferably are made in adjacent pairs, i.e. a deletion of 2 residues or insertion of 2 residues. Substitutions, deletions, insertions or any combination thereof may be combined to amve at a final construct. The mutations must not place the sequence out of reading frame and preferably, will not create complementary regions that could produce secondary mRNA structure. Substitutional variants are those in which at least one residue has been removed and a different residue inserted in its place. Such substitutions generally are made in accordance with the following Tables 1 and 2 and are referred to as conservative substitutions.
TABLE 1:Amino Acid Abbreviations Amino Acid Abbreviations alanine AlaA
allosoleucine AIle arginine ArgR
asparagine AsnN
aspartic acid AspD
cysteine CysC
glutamic acid GluE
Amino Acid Abbreviations glutamine G1nK
glycine G1yG
histidine HisH
isolelucine IleI
leucine LeuL
lysine LysK
phenylalanine PheF
proline ProP
pyroglutamic Glu acidp serine SerS
threonine ThrT
tyrosine TyrY
tryptophan TrpW
valine VaIV
TABLE 2: Amino Acid Substitutions Original Residue Exemplary Conservative Substitutions, others are known in the art.
Alaser Arglys, gln Asngln; his Aspglu Cysser Glnasn,lys Gluasp Glypro Hisasn;gln Ileleu; val Leuile; val Lysarg; gln;
MetLeu; ile Phemet; leu; tyr Serthr Thrser Trptyr Tyrtrp; phe Valile; leu Substantial changes in function or immunological identity are made by selecting substitutions that are less conservative than those in Table 2, i.e., selecting residues that differ more significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site or (c) the bulk of the side chain. The substitutions which in general are expected to produce the greatest changes in the protein properties will be those in which (a) a hydrophilic residue, e.g.
seryl or threonyl, is substituted for (or by) a hydrophobic residue, e.g. leucyl, isoleucyl, phenylalanyl, valyl or alanyl; (b) a cysteine or proline is substituted for (or by) any other residue; (c) a residue having an electropositive side chain, e.g., lysyl, arginyl, or histidyl, is substituted for (or by) an electronegative residue, e.g., glutamyl or aspartyl; or (d) a residue having a bulky side chain, e.g., phenylalanine, is substituted for (or by) one not having a side chain, e.g., glycine, in this case, (e) by increasing the number of sites for sulfation and/or glycosylation.
For example, the replacement of one amino acid residue with another that is biologically and/or chemically similar is known to those skilled in the art as a conservative substitution. For example, a conservative substitution would be replacing one hydrophobic residue for another, or one polar residue for another. The substitutions include combinations such as, for example, Gly, Ala; Val, Ile, Leu; Asp, Glu; Asn, Gln; Ser, Thr;
Lys, Arg; and Phe, Tyr. Such conservatively substituted variations of each explicitly disclosed sequence are included within the mosaic polypeptides provided herein.
Substitutional or deletional mutagenesis can be employed to insert sites for N-glycosylation (Asn-X-Thr/Ser) or 0-glycosylation (Ser or Thr). Deletions of cysteine or other labile residues also may be desirable. Deletions or substitutions of potential proteolysis sites, e.g. Arg, is accomplished for example by deleting one of the basic residues or substituting one by glutaminyl or histidyl residues.
Certain post-translational derivatizations are the result of the action of recombinant host cells on the expressed polypeptide. Glutaminyl and asparaginyl residues are frequently post-translationally deamidated to the corresponding glutamyl and asparyl residues.
Alternatively, these residues are deamidated under mildly acidic conditions.
Other post-translational modifications include hydroxylation of proline and lysine, phosphorylation of hydroxyl groups of seryl or threonyl residues, methylation of the o-amino groups of lysine, arginine, and histidine side chains (T.E. Creighton, Proteins: Structure and Molecular Properties, W. H. Freeman & Co., San Francisco pp 79-86 [1983]), acetylation of the N-terminal amine and, in some instances, amidation of the C-terminal carboxyl.
It is understood that one way to define the variants and derivatives of the disclosed proteins herein is through defining the variants and derivatives in terms of homology/identity to specific known sequences. For example, SEQ ID NO:xxx sets forth a particular sequence of DEFB 1 and SEQ ID NO:xxx sets forth a particular sequence of PAX2. Specifically disclosed are variants of these and other proteins herein disclosed which have at least, 70% or 75% or 80% or 85% or 90% or 95% homology to the stated sequence. Those of skill in the art readily understand how to determine the homology of two proteins. For example, the homology can be calculated after aligning the two sequences so that the homology is at its highest level.
Another way of calculating homology can be performed by published algorithms.
Optimal alignment of sequences for comparison may be conducted by the local homology algorithm of Smith and Waterman Adv. Appl. Math. 2: 482 (1981), by the homology alignment algorithm of Needleman and Wunsch, J. MoL Biol. 48: 443 (1970), by the search for similarity method of Pearson and Lipman, Proc. Natl. Acad. Sci. U.S.A. 85:
(1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by inspection.
The same types of homology can be obtained for nucleic acids by for example the algorithms disclosed in Zuker, M. Scierzce 244:48-52, 1989, Jaeger et al.
Proc. Natl. Acad.
Sci. USA 86:7706-7710, 1989, Jaeger et al.lVlethods Enzymol. 183:281-306, 1989 which are herein incorporated by reference for at least material related to nucleic acid alignment.
It is understood that the description of conservative mutations and homology can be combined together in any combination, such as embodiments that have at least 70%
homology to a particular sequence wherein the variants are conservative mutations.
As this specification discusses various proteins and protein sequences it is understood that the nucleic acids that can encode those protein sequences are also disclosed.
This would include all degenerate sequences related to a specific protein sequence, i.e. all nucleic acids having a sequence that encodes one particular protein sequence as well as all nucleic acids, including degenerate nucleic acids, encoding the disclosed variants and derivatives pf the protein sequences. Thus, while each particular nucleic acid sequence may not be written out herein, it is understood that each and every sequence is in fact disclosed and described herein through the disclosed protein sequence. For example, one of the many nucleic acid sequences that can encode the DEFB 1 protein sequence set forth in SEQ ID
NO:xxx is set forth in SEQ ID NO:xxx. It is also understood that while no amino acid -sequence indicates what particular DNA sequence encodes that protein within an organism, where particular variants of a disclosed protein are disclosed herein, the known nucleic acid sequence that encodes that protein in the particular DEFB 1 from which that protein arises is also known and herein disclosed and described.
It is understood that there are numerous arnino acid and peptide analogs which can be incorporated into the disclosed compositions. For example, there are numerous D amino acids or amino acids which have a different functional substituent then the amino acids shown in Table 1 and Table 2. The opposite stereo isomers of naturally occurring peptides are disclosed, as well as the stereo isomers of peptide analogs. These amino acids can readily be incorporated into polypeptide chains by charging tRNA molecules with the amino acid of choice and engineering genetic constructs that utilize, for example, amber codons, to insert the analog amino acid into a peptide chain in a site specific way (Thorson et al., Methods in Molec. Biol. 77:43-73 (1991), Zoller, Current Opinion in Biotechnology, 3:348-354 (1992); Ibba, Biotechnology & Genetic Enginerring Reviews 13:197-216 (1995), Cahill et al., TIBS, 14(10):400-403 (1989); Benner, TIB Tech, 12:158-163 (1994); Ibba and Hennecke, Bio/technology, 12:678-682 (1994) all of which are herein incorporated by reference at least for material related to amino acid analogs).
Molecules can be produced that resemble peptides, but which are not connected via a natural peptide linkage. For example, linkages for amino acids or amino acid analogs can include CH2NH--, --CH2S--, --CH2--CH2 --, --CH=CH-- (cis and trans), --COCH2 --, --CH(OH)CH2--, and --CHH2SO-(These and others can be found in Spatola, A. F. in Chemistry and Biochemistry of Amino Acids, Peptides, and Proteins, B.
Weinstein, eds., Marcel Dekker, New York, p. 267 (1983); Spatola, A. F., Vega Data (March 1983), Vol. 1, Issue 3, Peptide Backbone Modifications (general review); Morley, Trends Pharm Sci (1980) pp. 463-468; Hudson, D. et al., Int J Pept Prot Res 14:177-185 (1979) (--CH2NH--, CH2CH2--); Spatola et al. Life Sci 38:1243-1249 (1986) (--CH H2_--S); Hann J.
Chem. Soc Perkin Trans. I 307-314 (1982) (--CH--CH--, cis and trans); Almquist et al. J.
Med. Chem.
23:1392-1398 (1980) (--COCH2--); Jennings-White et al. Tetrahedron Lett 23:2533 (1982) (--COCH2--); Szelke et al. European Appin, EP 45665 CA (1982): 97:39405 (1982) (--CH(OH)CH2--); Holladay et al. Tetrahedron. Lett 24:4401-4404 (1983) (--C(OH)CHz--);
and Hruby Life Sci 31:189-199 (1982) (--CH2--S--); each of which is incorporated herein by reference. A particularly preferred non-peptide linkage is --CH2NH--. It is understood that peptide analogs can have more than one atom between the bond atoms, such as b-alanine, g-aminobutyric acid, and the like.
Amino acid analogs and analogs and peptide analogs often have enhanced or desirable properties, such as, more economical production, greater chemical stability, enhanced pharmacological properties (half-life, absorption, potency, efficacy, etc.), altered specificity (e.g., a broad-spectrum of biological activities), reduced antigenicity, and others.
D-amino acids can be used to generate more stable peptides, because D amino acids are not recognized by peptidases and such. Systematic substitution of one or more amino acids of a consensus sequence with a D-amino acid of the same type (e.g., D-lysine in place of L-lysine) can be used to generate more stable peptides. Cysteine residues can be used to cyclize or attach two or more peptides together. This can be beneficial to constrain peptides into particular conformations. (Rizo and Gierasch Ann. Rev. Biochem. 61:387 (1992), incorporated herein by reference).
Pharmaceutical carriers/Delivery of pharmaceutical products As described above, the compositions can also be administered in vivo in a pharmaceutically acceptable carrier. By "pharmaceutically acceptable" is meant a material that is not biologically or otherwise undesirable, i.e., the material may be administered to a subject, along with the nucleic acid or vector, without causing any undesirable biological effects or interacting in a deleterious manner with any of the other components of the pharmaceutical composition in which it is contained. The carrier would naturally be selected to minimize any degradation of the active ingredient and to minimize any adverse side effects in the subject, as would be well known to one of skill in the art.
The compositions may be administered orally, parenterally (e.g., intravenously), by intramuscular injection, by intraperitoneal injection, transdennally, extracorporeally, topically or the like, including topical intranasal administration or administration by inhalant. As used herein, "topical intranasal administration" means delivery of the compositions into the nose and nasal passages through one or both of the nares and can comprise delivery by a spraying mechanism or droplet mechanism, or through aerosolization of the nucleic acid or vector. Administration of the compositions by inhalant can be through the nose or mouth via delivery by a spraying or droplet mechanism.
Delivery can also be directly to any area of the respiratory system (e.g., lungs) via intubation. The exact amount of the compositions required will vary from subject to subject, depending on the species, age, weight and general condition of the subject, the severity of the allergic disorder being treated, the particular nucleic acid or vector used, its mode of administration and the like. Thus, it is not possible to specify an exact amount for every composition. However, an appropriate amount can be determined by one of ordinary skill in the art using only routine experimentation given the teachings herein.
Parenteral administration of the composition, if used, is generally characterized by injection. Injectables can be prepared in conventional forms, either as liquid solutions or suspensions, solid forms suitable for solution of suspension in liquid prior to injection, or as emulsions. A more recently revised approach for parenteral administration involves use of a slow release or sustained release system such that a constant dosage is maintained. See, e.g., U.S. Patent No. 3,610,795, which is incorporated by reference herein.
The materials may be in solution, suspension (for example, incorporated into microparticles, liposomes, or cells). These may be targeted to a particular cell type via antibodies, receptors, or receptor ligands. The following references are examples of the use of this technology to target specific proteins to tumor tissue (Senter, et al., Bioconiugate Chem., 2:447-451, (1991); Bagshawe, K.D., Br. J. Cancer, 60:275-281, (1989);
Bagshawe, et al., Br. J. Cancer, 58:700-703, (1988); Senter, et al., Bioconjugate Chem., 4:3-9, (1993);
Battelli, et al., Cancer Immunol. hnmunother., 35:421-425, (1992); Pietersz and McKenzie, hivmunolog. Reviews, 129:57-80, (1992); and Roffler, et al., Biochem.
Pharmacol, 42:2062-2065, (1991)). Vehicles such as "stealth" and other antibody conjugated liposomes (including lipid mediated drug targeting to colonic carcinoma), receptor mediated targeting of DNA through cell specific ligands, lymphocyte directed tumor targeting, and highly specific therapeutic retroviral targeting of murine glioma cells in vivo. The following references are examples of the use of this technology to target specific proteins to tumor tissue (Hughes et al., Cancer Research, 49:6214-6220, (1989); and Litzinger and Huang, Biochimica et Biophysica Acta, 1104:179-187, (1992)). In general, receptors are involved in pathways of endocytosis, either constitutive or ligand induced. These receptors cluster in clathrin-coated pits, enter the cell via clathrin-coated vesicles, pass through an acidified endosoine in which the receptors are sorted, and then either recycle to the cell surface, become stored intracellularly, or are degraded in lysosomes. The internalization pathways serve a variety of functions, such as nutrient uptake, removal of activated proteins, clearance of macromolecules, opportunistic entry of viruses and toxins, dissociation and degradation of ligand, and receptor-level regulation. Many receptors follow more than one intracellular pathway, depending on the cell type, receptor concentration, type of ligand, ligand valency, and ligand concentration. Molecular and cellular mechanisms of receptor-mediated endocytosis has been reviewed (Brown and Greene, DNA and Cell Biology 10:6, 399-409 (1991)).
-Pharmaceutically Acceptable Carriers The compositions, including DEFB1, DEFB1-encoding nucleic acids, oligonucleotide inhibitors of PAX2 binding, can be used therapeutically in combination with a pharmaceutically acceptable carrier.
Suitable carriers and their formulations are described in Remington: The Science and Practice of Phanmacy (19th ed.) ed. A.R. Gennaro, Mack Publishing Company, Easton, PA
1995. Typically, an appropriate amount of a pharmaceutically-acceptable salt is used in the formulation to render the formulation isotonic. Examples of the pharmaceutically-acceptable carrier include, but are not limited to, saline, Ringer's solution and dextrose solution. The pH of the solution is preferably from about 5 to about 8, and more preferably from about 7 to about 7.5. Further carriers include sustained release preparations such as semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g., films, liposomes or microparticles. It will be apparent to those persons skilled in the art that certain carriers may be more preferable depending upon, for instance, the route of administration and concentration of composition being administered.
Pharmaceutical carriers are known to those skilled in the art. These most typically would be standard carriers for administration of drugs to humans, including solutions such as sterile water, saline, and buffered solutions at physiological pH. The compositions can be administered intramuscularly or subcutaneously. Other compounds will be administered according to standard procedures used by those skilled in the art.
Pharmaceutical compositions may include carriers, thickeners, diluents, buffers, preservatives; surface active agents and the like in addition to the molecule of choice.
Pharmaceutical compositions may also include one or more active ingredients such as antimicrobial agents, antiinflammatory agents, anesthetics, and the like.
The pharmaceutical composition may be administered in a number of ways depending on whether local or systemic treatment is desired, and on the area to be treated. Administration may be topically (including ophthalmically, vaginally, rectally, intranasally), orally, by inhalation, or parenterally, for example by intravenous drip, subcutaneous, intraperitoneal or intramuscular injection. The disclosed antibodies can be administered intravenously, intraperitoneally, intramuscularly, subcutaneously, intracavity, or transdermally.
Preparations for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate. Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media. Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils. Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers (such as those based on Ringer's dextrose), and the like.
Preservatives and other additives may also be present such as, for example, antimicrobials, anti-oxidants, chelating agents, and inert gases and the like.
Formulations for topical administration may include ointments, lotions, creams, gels, drops, suppositories, sprays, liquids and powders. Conventional pharmaceutical carriers, aqueous, powder or oily bases, thickeners and the like may be necessary or desirable.
Compositions for oral administration include powders or granules, suspensions or solutions in water or non-aqueous media, capsules, sachets, or tablets.
Thickeners, flavorings, diluents, emulsifiers, dispersing aids or binders may be desirable..
Some of the compositions may potentially be administered as a pharmaceutically acceptable acid- or base- addition salt, formed by reaction with inorganic acids such as hydrochloric acid, hydrobromic acid, perchloric acid, nitric acid, thiocyanic acid, sulfuric acid, and phosphoric acid, and organic acids such as formic acid, acetic acid, propionic acid, glycolic acid, lactic acid, pyruvic acid, oxalic acid, malonic acid, succinic acid, maleic acid, and fumaric acid, or by reaction with an inorganic base such as sodium hydroxide, amm.onium hydroxide, potassium hydroxide, and organic bases such as mono-, di-, trialkyl and aryl amines and substituted ethanolamines.
Therapeutic Uses Effective dosages and schedules for administering the compositions may be determined empirically, and making such determinations is within the skill in the art.' The dosage ranges for the administration of the compositions are those large enough to produce the desired effect in which the symptoms disorder are effected. The dosage should not be so large as to cause adverse side effects, such as unwanted cross-reactions, anaphylactic reactions, and the like. Generally, the dosage will vary with the age, condition, sex and extent of the disease in the patient, route of administration, or whether other drugs are included in the regimen, and can be determined by one of skill in the art. The dosage can be adjusted by, the individual physician in the event of any counterindications.
Dosage can vary, and can be administered in one or more dose administrations daily, for one or several days. Guidance can be found in the literature for appropriate dosages for given classes of pharmaceutical products. For example, guidance in selecting appropriate doses for antibodies can be found in the literature on therapeutic uses of antibodies, e.g., Handbook of Monoclonal Antibodies, Ferrone et al., eds., Noges Publications, Park Ridge, N.J., (1985) ch. 22 and pp. 303-357; Smith et al., Antibodies in Human Diagnosis and Therapy, Haber et al., eds., Raven Press, New York (1977) pp. 365-389. A typical daily dosage of the oligonucleotide used alone might range from about 1 gg/kg to up to 100 mg/kg of body weight or more per day, depending on the factors mentioned above. In a more specific example, 5 to 7 mg/kg/day can be used. This is appropriate for i.v.
administration and higher dosages, up to about 150mg/m2/day s.c. are appropriate. This can be administered daily for a week in from 1 to 24 courses. See for example A Phase I
Pharmacokinetic and Biological Correlative Study of Oblimersen Sodium (Genasense, G3139), an Antisense Oligonucleotide to the Bcl-2 mRNA, and of Docetaxel in Patients with Hormone-Refractory Prostate Cancer, Clinical Cancer Research, Vol. 10, 5048-5057, August 1, 2004, incorporated herein for it's teaching of dosages for oligonucleotides.
Following administration of a disclosed composition for treating cancer, the efficacy of the therapeutic composition can be assessed in various ways well known to the skilled practitioner. For instance, one of ordinary skill in the art will understand that a composition, DEFB 1, DEFB 1-encoding nucleic acid, inhibitor of PAX2, disclosed herein is efficacious in treating cancer in a subject by observing that the composition reduces tumor load or prevents a fu.rther increase in tumor load. Methods of assessing tumor load are known in the art The compositions that inhibit the interactions between PAX2 and the DEFB 1 promoter can be administered prophylactically to patients or subjects who are at risk for cancer.
Other molecules that interact with PAX2 to inhibit its interaction with the promoter can be delivered in ways similar to those described for the pharmaceutical products.
The disclosed compositions and methods cain also be used for example as tools to isolate and test new drug candidates for a variety of related diseases. Thus, a method of identifying inhibitors of the binding of PAX2 to the DEFB 1 promoter is provided. The method can comprise contacting a system that expresses DEFB 1 with a putative inhibitor in the presence and/or absence of PAX2 to determine whether there is an inhibitory effect on this interaction.
Compositions identified by screening with disclosed compositions /
combinatorial chemistry Combinatorial chemistry The disclosed compositions can be used as targets for any combinatorial technique to identify molecules or macromolecular molecules that interact with the disclosed compositions in a desired way. Also disclosed are the compositions that are identified through combinatorial techniques or screening teclmiques in which the compositions disclosed as the PAX2 sequence or portions thereof (e.g., PAX2 DNA-binding domain), are used as the target in a combinatorial or screening protocol.
It is understood that when using the disclosed compositions in combinatorial techniques or screening methods, molecules, such as macromolecular molecules, will be identified that have particular desired properties such as inhibition or stimulation or the target molecule's fianction. The molecules identified and isolated when using the disclosed compositions, such as, DEFB1 or PAX2, are also disclosed. Thus, the products produced using the combinatorial or screening approaches that involve the disclosed compositions are also considered herein disclosed.
It is understood that the disclosed methods for identifying molecules that inhibit the interactions between, for example, DEFB1 promoter and.PAX2 can be performed using high through put means. For example, putative inhibitors can be. identified using Fluorescence Resonance Energy Transfer (FRET) to quickly identify interactions. The underlying theory of the techniques is that when two molecules are close in space, ie, interacting at a level beyond background, a signal is produced or a signal can be quenched.
Then, a variety of experiments can be performed, including, for example, adding in a putative inhibitor. If the inhibitor competes with the interaction between the two signaling molecules, the signals will be removed from each other in space, and this will cause a decrease or an increase in the signal, depending on the type of signal used.
This decrease or increasing signal can be correlated to the presence or absence of the putative inhibitor. Any signaling means can be used. For example, disclosed are methods of identifying an inhibitor of the interaction between any two of the disclosed molecules comprising, contacting a first molecule and a second molecule together in the presence of a putative inhibitor, wherein the first molecule or second molecule comprises a fluorescence donor, wherein the first or second molecule, typically the molecule not comprising the donor, comprises a fluorescence acceptor; and measuring Fluorescence Resonance Energy Transfer (FRET), in the presence of the putative inhibitor and the in absence of the putative inhibitor, wherein a decrease in FRET in the presence of the putative inhibitor as compared to FRET
measurement in its absence indicates the putative inhibitor inhibits binding between the two molecules. This type of inethod can be performed with a cell system as well.
Combinatorial chemistry includes but is not limited to all methods for isolating small molecules or macromolecules that are capable of binding either a small molecule or another macromolecule, typically in an iterative process. Proteins, oligonucleotides, and sugars are examples of macromolecules. For example, oligonucleotide molecules with a given function, catalytic or ligand-binding, can be isolated from a complex mixture of random oligonucleotides in what has been referred to as "in vitro genetics"
(Szostak, TIBS
19:89, 1992). One synthesizes a large pool of molecules bearing random and defined sequences and subjects that complex mixture, for example, approximately 1015 individual sequences in 100 g of a 100 nucleotide RNA, to some selection and enrichment process.
Through repeated cycles of affinity chromatography and PCR amplification of the molecules bound to the ligand on the column, Ellington and Szostak (1990) estimated that 1 in 1010 RNA molecules folded in such a way as to bind a small molecule dyes.
DNA
molecules with such ligand-binding behavior have been isolated as well (Ellington and Szostak, 1992; Bock et al, 1992). Techniques aimed at similar goals exist for small organic molecules, proteins, antibodies and other macromolecules known to those of skill in the art.
Screening sets of molecules for a desired activity whether based on small organic libraries, oligonucleotides, or antibodies is broadly referred to as combinatorial chemistry.
Combinatorial techniques are particularly suited for defining binding interactions between molecules and for isolating molecules that have a specific binding activity, often called aptamers when the macromolecules are nucleic acids.
There are a number of methods for isolating proteins which either have de novo activity or a modified activity. For example, phage display libraries have been used to isolate numerous peptides that interact with a specific target. (See for example, United States Patent No. 6,031,071; 5,824,520; 5,596,079; and 5,565,332 which are herein incorporated by reference at least for their material related to phage display and methods relate to combinatorial chemistry) A preferred method for isolating proteins that have a given function is described by Roberts and Szostak (Roberts R.W. and Szostak J.W. Proc. Natl. Acad. Sci. USA, 94(23)12997-302 (1997). This combinatorial chemistry method couples the functional power of proteins and the genetic power of nucleic acids. An RNA molecule is generated in which a puromycin molecule is covalently attached to the 3'-end of the RNA
molecule. An in vitro translation of this modified RNA molecule causes the correct protein, encoded by the RNA to be translated. In addition, because of the attachment of the puromycin, a peptdyl acceptor which cannot be extended, the growing peptide chain is attached to the puromycin which is attached to the RNA. Thus, the protein molecule is attached to the genetic material that encodes it. Normal in vitro selection procedures can now be done to isolate functional peptides. Once the selection procedure for peptide function is complete traditional nucleic acid manipulation procedures are performed to amplify the nucleic acid that codes for the selected functional peptides. After amplification of the genetic material, new RNA is transcribed with puromycin at the 3'-end, new peptide is translated and another functional round of selection is performed. Thus, protein selection can be performed in an iterative manner just like nucleic acid selection techniques. The peptide which is translated is controlled by the sequence of the RNA attached to the puromycin. This sequence can be anything from a random sequence engineered for optimum translation (i.e. no stop codons etc.) or it can be a degenerate sequence of a known RNA molecule to look for improved or altered function of a known peptide. The conditions for nucleic acid amplification and in vitro translation are well known to those of ordinary skill in the art and are preferably performed as in Roberts and Szostak (Roberts R.W. and Szostak J.W. Proc. Natl.
Acad. Sci.
USA, 94(23)12997-302 (1997)).
Another preferred method for combinatorial methods designed to isolate peptides is described in Cohen et al. (Cohen B.A.,et al., Proc. Natl. Acad. Sci. USA
95(24):14272-7' (1998)). This method utilizes and modifies two-hybrid technology. Yeast two-hybrid systems are useful for the detection and analysis of protein:protein interactions. The two-hybrid system, initially described in the yeast Saccharomyces cerevisiae, is a powerful molecular genetic technique for identifying new regulatory molecules, specific to the protein of interest (Fields and Song, Nature 340:245-6 (1989)). Cohen et al., modified this technology so that novel interactions between synthetic or engineered peptide sequences could be identified which bind a molecule of choice. The benefit of this type of technology is that the selection is done in an intracellular environment. The method utilizes a library of peptide molecules that attached to an acidic activation domain.
Using methodology well known to those of skill in the art, in combination with various combinatorial libraries, one can isolate and characterize those small molecules or macromolecules, which bind to or interact with the desired target. The relative binding affinity of these compounds can be compared and optimum compounds identified using competitive binding studies, which are well known to those of skill in the art.
Techniques for making combinatorial libraries and screening combinatorial libraries to isolate molecules which bind a desired target are well known to those of skill in the art.
Representative techniques and methods can be found in but are not limited to United States patents 5,084,824, 5,288,514, 5,449,754, 5,506,337, 5,539,083, 5,545,568, 5,556,762, 5,565,324, 5,565,332, 5,573,905, 5,618,825, 5,619,680, 5,627,210, 5,646,285, 5,663,046, 5,670,326, 5,677,195, 5,683,899, 5,688,696, 5,688,997, 5,698,685, 5,712,146, 5,721,099, 5,723,598, 5,741,713, 5,792,431, 5,807,683, 5,807,754, 5,821,130, 5,831,014, 5,834,195, 5,834,318, 5,834,588, 5,840,500, 5,847,150, 5,856,107, 5,856,496, 5,859,190, 5,864,010, 5,874,443, 5,877,214, 5,880,972, 5,886,126, 5,886,127, 5,891,737, 5,916,899, 5,919,955, 5,925,527, 5,939,268, 5,942,387, 5,945,070, 5,948,696, 5,958,702, 5,958,792, 5,962,337, 5,965,719, 5,972,719, 5,976,894, 5,980,704, 5,985,356, 5,999,086, 6,001,579, 6,004,617, 6,008,321, 6,017,768, 6,025,371, 6,030,917, 6,040,193, 6,045,671, 6,045,755, 6,060,596, and 6,061,636.
Combinatorial libraries can be made from a wide array of molecules using a number of different synthetic techniques. For example, libraries containing fused 2,4-pyrimidinediones (United States patent 6,025,371) dihydrobenzopyrans (United States Patent 6,017,768and 5,821,130), amide alcohols (United States Patent 5,976,894), hydroxy-amino acid amides (United States Patent 5,972,719) carbohydrates (United States patent 5,965,719), 1,4-benzodiazepin-2,5-diones (United States patent 5,962,337), cyclics (United States patent 5,958,792), biaryl amino acid amides (United States patent 5,948,696), thiophenes (United States patent 5,942,387), tricyclic Tetrahydroquinolines (United States patent 5,925,527), benzofurans (United States patent 5,919,955), isoquinolines (United States patent 5,916,899), hydantoin and thiohydantoin (United States patent 5,859,190), indoles (United States patent 5,856,496), imidazol-pyrido-indole and imidazol-pyrido-benzothiophenes (United States patent 5,856,107) substituted 2-methylene-2, 3-dihydrothiazoles (United States patent 5,847,150), quinolines (United States patent 5,840,500), PNA (United States patent 5,831,014), containing tags (United States patent 5,721,099), polyketides (United States patent 5,712,146), morpholino-subunits (United States patent 5,698,685 and 5,506,337), sulfamides (United States patent 5,618,825), and benzodiazepines (United States patent 5,288,514).
Screening molecules similar to the disclosed siRNA molecules for inhibition of PAX2 suppression of DEFB 1 expresson is a method of isolating desired compounds.
Molecules isolated which can either be competitive inhibitors or non-competitive inhibitors.
In another embodiment the inhibitors are non-competitive inhibitors. One type of non-competitive inhibitor will cause allosteric rearrangements.
As used herein combinatorial methods and libraries included traditional screening methods and libraries as well as methods and libraries used in iterative processes.
Computer assisted drug design The disclosed compositions can be used as targets for any molecular modeling technique to identify either the structure of the disclosed compositions or to identify potential or actual molecules, such as small molecules, which interact in a desired way with the disclosed compositions. The nucleic acids, peptides, and related molecules disclosed herein can be used as targets in any molecular modeling program or approach.
It is understood that when using the disclosed compositions in modeling techniques, molecules, such as macroniolecular molecules, will be identified that have particular desired properties such as inhibition or stimulation of the target molecule's function. The molecules identified and isolated when using the disclosed compositions, such as, SEQ ID
NO:1, are also disclosed. Thus, the products produced using the molecular modeling approaches that involve the disclosed compositions, such as, SEQ ID NO:1, are also considered herein disclosed.
Thus, one way to isolate molecules that bind a molecule of choice is through rational design. This is achieved through structural information and computer modeling.
Computer modeling technology allows visualization of the three-dimensional atomic structure of a selected molecule and the rational design of new compounds that will interact with the molecule. The three-dimensional construct typically depends on data from x-ray crystallographic analyses or NMR imaging of the selected molecule. The molecular dynamics require force field data. The computer graphics systems enable prediction of how a new compound will link to the target molecule and allow experimental manipulation of the structures of the compound and target molecule to perfect binding specificity.
Prediction of what the molecule-compound interaction will be when small changes are made in one or both requires molecular mechanics software and computationally intensive computers, usually coupled with user-friendly, menu-driven interfaces between the molecular design program and the user.
Examples of molecular modeling systems are the CHARMm and QUANTA
programs, Polygen Corporation, Waltham, MA. CHARMm performs the energy minimization and molecular dynamics functions. QUANTA performs the construction, graphic modeling and analysis of molecular structure. QUANTA allows interactive construction, modification, visualization, and analysis of the behavior of molecules with each other.
A number of articles review computer modeling of drugs interactive with specific proteins, such as Rotivinen, et al., 1988 Acta Pharmaceutica Fennica 97, 159-166; Ripka, New Scientist 54-57 (June 16, 1988); McKinaly and Rossmann, 1989 Annu. Rev.
PharmacoL. Toxiciol. 29, 111-122; Perry and Davies, 4SAR: Quantitative Structure-Activity Relationships in DrugDesign pp. 189-193 (Alan R. Liss, Inc. 1989);
Lewis and Dean, 1989 Proc. R. Soc. Lond. 236, 125-140 and 141-162; and, with respect to a model enzyme for nucleic acid components, Askew, et al., 1989 J. Am. Chem. Soc. 111, 1090. Other computer programs that screen and graphically depict chemicals are available from companies such as BioDesign, Inc., Pasadena, CA., Allelix, Inc, Mississauga, Ontario, Canada, and Hypercube, Inc., Cambridge, Ontario. Although these are primarily designed for application to drugs specific to particular proteins, they can be adapted to design of molecules specifically interacting with specific regions of DNA or RNA, once that region is identified.
Although described above with reference to design and generation of compounds which could alter binding, one could also screen libraries of known compounds, including natural products or synthetic chemicals, and biologically active materials, including proteins, for compounds which alter substrate binding or enzymatic activity.
Computer readable mediums It is understood that the disclosed nucleic acids and proteins can be represented as a sequence consisting of the nucleotides of amino acids. There are a variety of ways to display these sequences, for example the nucleotide guanosine can be represented by G or g.
Likewise the amino acid valine can be represented by Val or V. Those of skill in the art understand how to display and express any nucleic acid or protein sequence in any of the variety of ways that exist, each of which is considered herein disclosed.
Specifically contemplated herein is the display of these sequences on computer readable mediums, such as, commercially available floppy disks, tapes, chips, hard drives, compact disks, and video disks, or other computer readable mediums. Also disclosed are the binary code representations of the disclosed sequences. Those of skill in the art understand what computer readable mediums. Thus, computer readable mediums on which the nucleic acids or protein sequences are recorded, stored, or saved.
Disclosed are computer readable mediums comprising the sequences and information regarding the sequences set forth herein. Also disclosed are computer readable mediums comprising the sequences and information regarding the sequences set forth.
The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how the compounds, compositions, articles, devices and/or methods claimed herein are made and evaluated, and are intended to be purely exemplary and are not intended to limit the disclosure. Efforts have been made to ensure accuracy with respect to numbers (e.g., amounts, temperature, etc.), but some errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, temperature is in C or is at ambient temperature, and pressure is at or near atmospheric.
The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how the compounds, compositions, articles, devices and/or methods claimed herein are made and evaluated, and are intended to be purely exemplary of the invention and are not intended to limit the scope of what the inventors regard as their invention. Efforts have been made to ensure accuracy with respect to numbers (e.g., amounts, temperature, etc.), but some errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, temperature is in C or is at ambient temperature, and pressure is at or near atmospheric.
Example I
Human Beta Defensin-1 is Cytotoxic to Late-Stage Prostate Cancer and Plays a Role in Prostate Cancer Tumor Immunity Abstract DEFB 1 was cloned into an inducible expression system to examine what effect it had on normal prostate epithelial cells, as well as androgen receptor positive (AR~) and androgen receptor negative (AR") prostate cancer cell lines. Induction of DEFB
1 expression resulted in a decrease in cellular growth in AK cells DU145 and PC3, but had no effect on the growth of the AR+ prostate cancer cells LNCaP. DEFBl also caused rapid induction of caspase-mediated apoptosis. Data presented here are the first to provide evidence of its role in innate tumor immunity and indicate that its loss contributes to tumor progression in prostate cancer.
Materials and Methods Cell Lines The cell lines DU145 were cultured in DMEM medium, PC3 were grown in F12 medium, and LNCaP were grown in RPMI medium (Life Technologies, Inc., Grand Island, NY). Growth media for all three lines was supplemented with 10% (v/v) fetal bovine serum (Life Technologies). The hPrEC cells were cultured in prostate epithelium basal media (Cambrex Bio Science, Inc., Walkersville, MD). All cell lines were maintained at 37 C and 5% CO2.
Tissue Samples and Laser Capture Microdissection Prostate tissues obtained from consented patients that underwent radical prostatectomy were acquired through the Hollings Cancer Center tumor bank in accordance with an Institutional Review Board-approved protocol. This included guidelines for the processing, sectioning, histological characterization, RNA purification and PCR
amplification of samples. Following, pathologic examination of frozen tissue sections, laser capture microdissection (LCM) was performed to ensure that the tissue samples assayed consisted of pure populations of benign prostate cells. For each tissue section analyzed, LCM was performed at three different regions containing benign tissue and the cells collected were then pooled.
Cloning ofDEFBl Gene DEFB1 cDNA was generated from RNA by reverse transcription-PCR. The PCR
primers were designed to contain Clal and Kpnl restriction sites. DEFB 1 PCR
products were restriction digested with Clal and KpnI and ligated into a TA cloning vector. The TA/DEFB 1 vector was then transfected into E. coli by heat shock and individual clones were selected and expanded. Plasmids were isolated by Cell Culture DNA
Midiprep (Qiagen, Valencia, CA) and sequence integrity verified by automated sequencing. The DEFB 1 gene fragment was then ligated into the pTRE2 digested with Clal and Kpnl, which served as an intermediate vector for orientation purposes. Then the pTRE2/DEFB
construct was digested with Apal and KpnI to excise the DEFB 1 insert, which was ligated into pIND vector of the Ecdysone Inducible Expression System (Invitrogen, Carlsbad, CA) also double digested with Apal and Kpnl. The construct was again transfected into E. coli and individual clones were selected and expanded. Plasmids were isolated and sequence integrity of p1ND/DEFB 1 was again verified by automated sequencing.
Transfection Cells (1 x 106) were seeded onto 100-mm Petri dishes and grown overnight. Then the cells were co-transfected using Lipofectamine 2000 (Invitrogen, Carlsbad, CA) with 1 g of pVgRXR plasmid, which expresses the heterodimeric ecdysone receptor, and 1 g of the pIND/DEFB 1 vector construct or empty pIND control vector in Opti-MEM
media (Life Technologies, Inc., Grand Island, NY).
RNA Isolation and Quantitative RT-PCR
In order to verify DEFB 1 protein expression in the cells transfected with construct, RNA was collected after a 24 hour induction period with Ponasterone A (Pon A).
Briefly, total RNA was isolated using the SV Total RNA Isolation System (Promega, Madison, WI) from approximately 1X 106 cells harvested by trypsinizing. Here, cells were lysed and total RNA was isolated by centrifugation through spin columns. For cells collected by LCM, total RNA was isolated using the PicoPure RNA Isolation Kit (Arcturus Biosciences, Mt. View, CA) following the manufacturer's protocol. Total RNA
(0.5 g per reaction) from both sources was reverse transcribed into cDNA utilizing random primers (Promega). AMV Reverse Transcriptase II enzyme (500 units per reaction;
Promega) was used for first strand synthesis and Tfl DNA Polymerase for second strand synthesis (500 units per reaction; Promega) as per the manufacturer's protocol. In each case, 50 pg of cDNA was used per ensuing PCR reaction. Two-step QRT-PCR was performed on cDNA
generated using the MultiScribe Reverse Transcripatase from the TaqMan Reverse Transcription System and the SYBR Green PCR Master Mix (Applied Biosystems).
The primer pair for DEFB 1(Table 3) was generated from the published DEFB1 sequence (GenBank Accession No. U50930)10. Forty cycles of PCR were performed under standard conditions using an annealing temperature of 56 C. In addition, ,6-actin (Table 3) was amplified as a housekeeping gene to normalize the initial content of total cDNA.
DEFB 1 expression was calculated as the relative expression ratio between DEFB
1 and ,6-actin and was compared in cells lines induced and uninduced for DEFBl expression, as well as LCM benign prostatic tissue. As a negative control, QRT-PCR reactions without cDNA
template were also performed. All reactions were run three times in triplicate.
MTT Cell Viability Assay To examine the effects of DEFBI on cell growth, metabolic 3-[4,5-dimethylthiazol-2y1]-2,5 diphenyl tetrazolium bromide (MTT) assays were performed. PC3, DU145 and LNCaP cells co-transfected with pVgRXR plasmid and pIND/DEFB1 construct or empty pIND vector were seeded onto a 96-well plate at 1-5 x103 cells per well.
Twenty-four hours after seeding, fresh growth medium was added containing 10 M Ponasterone A
daily to induce DEFB 1 expression for 24-, 48- and 72 hours after which the MTT assay was performed according to the manufacturer's instructions (Promega). Reactions were performed three times in triplicate.
Flow Cytometry PC3 and DU145 cells co-transfected with the DEFB 1 expression system were grown in 60-mm dishes and induced for 12, 24, and 48 hours with 10 M Ponasterone A.
Following each incubation period, the medium was collected from the plates (to retain any detached cells) and combined with PBS used to wash the plates. The remaining attached cells were harvested by trypsinization and combined with the detached cells and PBS. The cells were then pelleted at 4 C (500 x g) for 5 min, washed twice in PBS, and resuspended in 100ul of lx Annexin binding buffer (0.1 M Hepes/NaOH at pH 7.4, 1.4 M NaCl, 25 mM
CaC12) containing 5[t1 of Annexin V-FITC and 5 gl of PI. The cells were incubated at RT
for 15 min in the dark, then diluted with 400 l of lx Annexin binding buffer and analyzed by FACscan (Becton Dickinson, San Jose, CA). All reactions were performed three times.
Microscopic Analysis Cell morphology was analyzed by phase contrast microscopy. DU145, PC3 and LNCaP cells containing no vector, empty plasmid or DEFB 1 plasmid were seeded onto 6 well culture plates (BD Falcon, USA). The following day plasmid-containing cells were induced for a period of 48h with media containing 10 M Ponasterone A, while control cells received fresh media. The cells were then viewed under an inverted Zeiss microscope (Carl Zeiss, Germany). Phase contrast pictures of a field of cells were obtained using the SPOT Insight Mosaic 4.2 camera (Diagnostic Instruments, USA). Cells were examined by phase contrast microscopy under 32X magnification and digital images were stored as uncompressed TIFF files and exported into Photoshop CS software (Adobe Systems, San Jose, CA) for image processing and hard copy presentation.
Caspase Detection Detection of caspase activity in the prostate cancer cell lines was performed using APO LOGIXTM Carboxyfluorescin Caspase detection kit (Cell Technology, Mountain View, CA). Active caspases were detected through the use of a FAM-VAD-FMK
inhibitor that irreversibly binds to active caspases. Briefly, DU145 and PC3 cells (1.5-3 X105) containing the DEFB 1 expression system were plated in 35 mm glass bottom microwell dishes (Matek, Ashland, MA) and treated for 24 hours with media only or with media containing PonA as previously described. Next, 10 l of a 30X working dilution of carboxyfluorescein labeled peptide fluoromethyl ketone (FAM-VAD-FMK) was added to 300 1 of media and added to each 35 mm dish. Cells were then incubated for 1 hour at 37 C under 5% CO2. Then, the medium was aspirated and the cells were washed twice with 2 ml of a 1X Working dilution Wash Buffer. Cells were viewed under differential interference contrast (DIC) or under laser excitation at 488nm. The fluorescent signal was analyzed using a confocal microscope (Zeiss LSM 5 Pascal) and a 63X DIC oil lens with a Vario 2 RGB Laser Scanning Module.
Statistical Analysis Statistical differences were evaluated using the Student's t-test for unpaired values.
P values were determined by a two-sided calculation, and a P value of less than 0.05 was considered statistically significant.
Results DEFBl Expression in Prostate Tissue and Cell Lines DEFB1 expression levels were measured by QRT-PCR in benign and malignant prostatic tissue, hPrEC prostate epithelial cells and DU145, PC3 and LNCaP
prostate cancer cells. DEFB1 expression was detected in all of the benign clinical samples.
The average amount of DEFB1 relative expression was 0.0073. In addition, DEFB1 relative expression in hPrEC cells was 0.0089. There was no statistical difference in DEFB1 expression detected in the benign prostatic tissue samples and hPrEC (Figure 1A).
Analysis of the relative DEFB 1 expression levels in the prostate cancer cell lines revealed significantly lower levels in DU145, PC3 and LNCaP. As a further point of reference, relative DEFB1 expression was measured in the adjacent malignant section of prostatic tissue from patient #1215. There were no significant differences in the level of DEFB1 expression observed in the three prostate cancer lines compared to malignant prostatic tissue from patient #1215 (Figure 1B). In addition, expression levels in all four samples were close to the no template negative controls which confirxned little to no endogenous DEFB 1 expression (data not shown). QRT-PCR was also performed on the prostate cancer cell lines transfected with the DEFB1 expression system. Following a 24 hour induction period, relative expression levels were 0.01360 in DU145, 0.01503 in PC3 and 0.138 in LNCaP. Amplification products were verified by gel electrophoresis.
QRT-PCR was performed on LCM tissues regions containing benign, PIN and cancer. DEFB 1 relative expression was 0.0146 in the benign region compared to 0.0009 in the malignant region (Figure 1 C.). This represents a 94% decrease which again demonstrates a significant down-regulation of expression. Furthermore, analysis of PIN
revealed that DEFB1 expression level was 0.044 which was a 70% decrease.
Conzparing expression in patient #1457 to the average expression level found in benign regions of six other patients (Figure 1 A.) revealed a ratio of 1.997 representing almost twice as much expression (Figure 1D.). However, the expression ratio was 0.0595 in PIN and was 0.125 in malignant tissue compared to average expression levels in benign tissue.
DEFB1 Causes Cell Membrane Permeability and Ruffling Induction of DEFB1 in the prostate cancer cell lines resulted in a significant reduction in cell number in DU145 and PC3, but had no effect on cell proliferation in LNCaP (Figure 2). As a negative control, cell proliferation was monitored in all three lines containing empty plasmid. There were no observable changes in cell morphology in DU145, PC3 or LNCaP cells following the addition of PonA. In addition, DEFB1 induction resulted in morphological changes in both DU145 and PC3. Here cells appeared more rounded and exhibited membrane ruffling indicative of cell death.
Apoptotic bodies were also present in both lines.
Expression of DEFBl Results in Decreased Cell Viability The MTT assay showed a reduction in cell viability by DEFBl in PC3 and DU145 cells, but no significant effect on LNCaP cells (Figure 3). After 24 hours, relative cell viability was 72% in DU145 and 56% in PC3. Analysis 48 hours after induction revealed 49% cell viability in DU145 and 37% cell viability in PC3. After 72 hours of DEFBl expression resulted in 44% and 29% relative cell viability in DU145 and PC3 cells, respectively.
DEFBl Causes Rapid Caspase-mediated Apoptosis in Late-stage Prostate Cancer Cells In order to determine whether the effects of DEFBl on PC3 and DU145 were cytostatic or cytotoxic, FACS analysis was performed. Under normal growth conditions, more than 90% of PC3 and DU145 cultures were viable and non-apoptotic (lower left quadrant) and did not stain with annexin V or PI (Figure 4). After inducing expression in PC3 cells, the number of apoptotic cells (lower and upper right quadrants) totaled 10% at 12 hours, 20% at 24 hours, and 44% at 48 hours. For DU145 cells, the number of apoptotic cells totaled 12% after 12 hours, 34% at 24 hours, and 59%
after 48 hours of induction. There was no-increase in apoptosis observed in cells containing empty plasmid following induction with PonA (data not shown).
Caspase activity was determined by confocal laser microscopic analysis (Figure 5).
DU145 and PC3 cell were induced for DEFB 1 expression and activity was monitored based on the binding of green fluoresing FAM-VAD-FMK to caspases in cells actively undergoing apoptosis. Analysis of cells under DIC showed the presence of viable control DU145 (A), PC3 (E) and LNCaP (1) cells at 0 hours. Excitation by the confocal laser at 488 nm produced no detectable green staining which indicates no caspase activity in DU145 (B), PC3 (F) or LNCaP (J). Following induction for 24 hours, DU145 (C), PC3 (G) and LNCaP (K) cells were again visible under DIC. Confocal analysis under fluorescence revealed green staining in DU145 (D) and PC3 (H) cell indicating caspase activity.
However, there was no green staining in LNCaP (L), indicating no induction of apoptosis by DEFB 1.
siRNA Silencing of PAX2 I In order to achieve efficient gene silencing, a pool of four complementary short interfering ribonucleotides (siRNAs) targeting human PAX2 mRNA (Accession No.
NM 003989.1), were synthesized (Dharmacon Research, Lafayette, CO, USA). A
second pool of four siRNAs were used as an internal control to test for the specificity of PAX2 siRNAs. Two of the sequences synthesized target the GL2 luciferase mRNA
(Accession No. X65324), and two were non-sequence-specific (Table 4). For annealing of siRNAs, 35 M of single strands were incubated in annealing buffer (100 mM potassium acetate, 30 mM
HEPES-KOH at pH 7.4, 2 mM magnesium acetate) for 1 min at 90 C followed by 1 h incubation at 37 C.
Western Analysis Briefly, cells were harvested by trypsinization and washed twice with PBS.
Lysis buffer was prepared according to the manufacturer's instructions (Sigma), and was then added to the cells. Following a 15 minute incubation period at 4 C on an orbital shaker, cell lysate were then collected and centrifuged for 10 minutes at 12000xg to pellet cellular debris. The protein-containing supernatant were then collected and quantitated. Next, 25 gg protein extract was loaded onto an 8-16% gradient SDS-PAGE (Novex).
Following electrophoresis, proteins were transferred to PVDF membranes, and then blocked with 5%
nonfat dry milk in TTBS (0.05% Tween 20 and 100mM Tris-Cl) for 1 hour. Blots were then probed with rabbit anti-Pax2 primary antibody (Zymed, San Francisco, CA) at a 1:2000 dilution. After washing, the membranes were incubated with anti-rabbit antibody conjugated to horseradish peroxidase (HRP) (dilution 1:5000; Sigma), and signal detection was visualized using chemilluminescence reagents (Pierce) on an Alpha Innotech Fluorchem 8900. As a control, blots were stripped and reprobed with mouse anti-,6-actin primary antibody (1:5000; Sigma-Aldrich) and HRP- conjugated anti-mouse secondary antibody (1:5000; Sigma-Aldrich) and signal detection was again visualized.
Plaase Contrast Microscopy The effect of PAX2 knock-down on cell growth was analyzed by phase contrast microscopy. Here, 1-2 xl04 cells were seeded onto 6 well culture plates (BD
Falcon, USA).
The following day cells were treated with media only, negative control non-specific siRNA
or PAX2 siRNA and allowed to incubate for six days. The cells were then viewed under an inverted Zeiss IM 35 microscope (Carl Zeiss, Germany) at 32x magnification.
Phase contrast pictures of a field of cells were obtained using the SPOT Insight Mosaic 4.2 camera (Diagnostic Instruments, USA).
MTT Cytotoxicity Assay DU145, PC3 and LNCaP cells (1x105) were transfected with 0.5gg of the PAX2 siRNA pool or control siRNA pool using Codebreaker transfection reagent according to the manufacturer's protocol (Promega). Next, cell suspensions were diluted and seeded onto a 96-well plate at 1-5 x103 cells per well and allowed to grow for 2-, 4- or 6 days. After culture, cell viability was determined by measuring the conversion of 3-[4,5-dimethylthiazol-2yl]-2,5 diphenyl tetrazolium bromide, MTT (Promega), to a colored formazan product. Absorbance was read at 540 nm on a scanning multiwell spectrophotometer.
Pan-Caspase Detection Detection of caspase activity in the prostate cancer cell lines was performed using APO LOGIXTM Carboxyfluorescin Caspase detection kit (Cell Technology, Mountain View, CA). Active caspases were detected through the use of a FAM-VAD-FMK
inhibitor that irreversibly binds to active caspases. Briefly, cells (1-2 X104) onto 35 mm glass bottom microwell dishes (Matek, Ashland, MA) and treated with media only or siRNA as previously described. Next, 10 l of a 30X working dilution of carboxyfluorescein labeled peptide fluoromethyl ketone (FAM-VAD-FMK) was added to 300g1 of media and added to each 35 mm dish. Cells were then incubated for 1 hour at 37 C under 5% CO2. Then, the medium was aspirated and the cells were washed twice with 2 ml of a 1X Working dilution Wash Buffer. Cells were viewed under differential interference contrast (DIC) or under laser excitation at 488nm. The fluorescent signal was analyzed using a confocal microscope (Zeiss LSM 5 Pascal) and a 63X DIC oil lens with a Vario 2 RGB Laser Scanning Module.
Quantitative Real-time RT-PCR
Quantitative real-time RT-PCR was performed in order to verify gene expression after PAX2 siRNA treatment in PC3, DU145 and LNCaP cell lines. Total RNA was isolated using the SV Total RNA Isolation System (Promega). Briefly, approximately 1 x 106 cells were harvested by trypsinizing, and rinsed in PBS. Cells were then lysed and total RNA was isolated by centrifugation through spin columns. Total RNA (0.5 g per reaction) was reverse transcribed into cDNA utilizing Oligo (dT) 15 primer (Promega) and AMV
Reverse Transcriptase II enzyme (500 units per reaction; Promega) for first strand synthesis and Tfl DNA Polymerase for for second strand synthesis (500 units per reaction; Promega) as per the manufacturers' protocol, with identical control samples treated without RT
enzyme. Typically, 50 pg of each cDNA was used per ensuing PCR reactionTwo-step QRT-PCR was performed on cDNA generated using the MultiScribe Reverse Transcripatase from the TaqMan Reverse Transcription System and the SYBR Green PCR Master Mix (PE
Biosystems). The primer pairs for BAX, BID and BAD were generated from the published sequences (Table3). Reactions were performed in MicroAmp Optical 96-well Reaction Plate (PE Biosystems). Forty cycles of PCR were performed under standard conditions using an annealing temperature of 60 C. Quantification was determined by the cycle nuinber where exponential amplification began (threshold value) and averaged from the values obtained from the triplicate repeats. There was an inverse relationship between message level and threshold value. In addition, GAPDH was used as a housekeeping gene to normalize the initial content of total cDNA. Gene expression was calculated as the relative expression ratio between the pro-apoptotic genes and GAPDH. All reactions were carried out in triplicate.
Results siRNA Inhibition of PAX2 Protein In order to confirm that the siRNA effective targeted the PAX2 mRNA, Western Analysis was performed to monitor PAX2 protein expression levels over a six day treatment period. Cells were given a single round of transfection with the pool of PAX2 siRNA. The results confirmed specific targeting of PAX2 mRNA by showing knock-down of protein by day four in DU145 (Figure 6a) and by day six in PC3 (Figure 6b).
Knock-down of PAX2 itahibit Prostate Cancer Cell Growtla Cells were analyzed following a six day treatment period with media only, negative control non-specific siRNA or PAX2 siRNA (Figure 7). DU145 (a), PC3 (d) and LNCaP
(g) cells all reached at least 90% confluency in the culture dishes containing media only.
Treatment of DU145 (b), PC3 (e) and LNCaP (h) with negative control non-specific siRNA
had no effect on cell growth, and cells again reached confluency after six days. However, treatment with PAX2 siRNA resulted in a significant decrease in cell number.
DU145 cells were approximately 15% confluent (c) and PC3 cells were only 10% confluent (f). LNCaP
cell were 5% confluent following siRNA treatment.
Cytotoxicity Assays Cell viability was measured after two-, four-, and six-day exposure times, and is expressed as a ratio of the 570-630 nm absorbance of treated cells divided by that of the untreated control cells (Figure 8). Relative cell viability following 2 days of treatment was 77% in LNCaP, 82% in DU145 and 78 % in PC3. After four days, relative cell viability was 46% in LNCaP, 53% in DU145 and 63% in PC3. After six days of treatment, relative cell viability decreased to 31% in LNCaP, 37% in PC3, and was 53% in DU145. As negative controls, cell viability was measured in after a six day treatment period with negative control non-specific siRNA or transfection reagent alone. For both conditions, there was no statistically significant change in cell viability compared to normal growth media (data not shown).
Pan-Caspase Detection Caspase activity was detected by confocal laser microscopic analysis. DU145, and LNCaP cells were treated with PAX2 siRNA and activity was monitored based on the binding of FAM-labeled peptide to caspases in cells actively undergoing apoptosis which will fluoresce green. Analysis of cells with media only under DIC shows the presence of viable DU145 (A), PC3 (E) and LNCaP (I) cells at 0 hours (Figure 9).
Excitation by the confocal laser at 488 nm produced no detectable green staining which indicates no caspase activity in untreated DU145 (B), PC3 (F) or LNCaP (J). Following four days of treatment with PAX2 siRNA, DU145 (C), PC3 (G) and LNCaP (K) cells were again visible under DIC. Under fluorescence, the treated DU145 (D), PC3 (H) and LNCaP (L) cells presented green staining indicating caspase activity.
Effect of Pax2 Inhibition on Pro-apoptotic Factors DU145, PC3 and LNCaP cells were treated with siRNA against PAX2 for six days and expression of pro-apoptotic genes dependent and independent of p53 transcription regulation were measured to monitor cell death pathways. For BAX, there was a 1.81-fold increase in LNCaP, a 2.73-fold increase in DU145, and a 1.87-fold increase in PC3 (Figure 10a). Expression levels of BID increased by 1.38-fold in LNCaP and 1.77-fold in DU145 (Figure lOb). However, BID expression levels decreased by 1.44-fold in PC3 following treatment (Figure lOc). Analysis of BAD revealed a 2.0-fold increase in expression in LNCaP, a 1.38-fold increase in DU145, and a 1.58-fold increase in PC3.
Conclusion Despite significant advances in cancer therapy there is still little progress in the treatment of advanced disease. Successful drug treatment of prostate cancer requires the use of therapeutics with specific effects on target cells while maintaining minimal clinical effects on the host. The goal of cancer therapy is to trigger tumor-selective cell death.
Therefore, understanding the mechanisms in such death is critical in determining the efficacy of a specific treatment.
The dependency of prostate cancer cell survival on PAX2 expression is shown here.
In order to distinguish between death observed in the p53-expressing cell line LNCaP, the p53-mutated line DU145, and the p53-null line PC3 downstream events that follow p53 activation as a result of PAX2 knock-down were examined. Caspase activity was detected in all three lines indicative of the initiation of programmed cell death. With this, changes in the expression of pro-apoptotic genes were examined. Here, BAX expression was upregulated in all three cell lines independent of p53 status. The expression of pro-apoptotic factor BAD was increased in all three lines following PAX2 inhibition.
Following treatment with PAX2 siRNA, BID expression was increased in LNCaP and DU145, but actually decreased in PC3. This indicates that cell death observed in prostate cancer is influenced by but is not dependent on p53 expression. The initiation of apoptosis in prostate cancer cells through different cell death pathways irrespective of p53 status indicates that PAX2 inhibits other tumor suppressors Example III
Inhibition of PAX2 Oncogene Results in DEFB1-Mediated Death of Prostate Cancer Cells Abstract The identification of tumor-specific molecules that serve as targets for the development of new cancer drugs is considered to be a major goal in cancer research.
Example I demonstrated that there is a high frequency of DEFBl expression loss in prostate cancer, and that induction of DEFB1 expression results in rapid apoptosis in androgen receptor negative-stage prostate cancer. These data show that DEFB 1 plays a role in prostate tumor suppression. In addition, given that it is a naturally occurring component of the immune system of normal prostate epithelium, DEFB1 is expected to be a viable therapeutic agent with little to no side effects. Example II demonstrated that inhibition of PAX2 expression results in prostate cancer cell death independent of p53.
These data indicate that there is an addition pro-apoptotic factor or tumor suppressor that is inhibited by PAX2. In addition, the data show that the oncogenic factor PAX2, which is over-expressed in prostate cancer, is a transcriptional repressor of DEFB1. The purpose of this study is to determine if DEFB 1 loss of expression is due to aberrant expression of the PAX2 oncogene, and whether inhibiting PAX2 results in DEFB 1-mediated cell death.
The data show that loss of DEFB1 expression occurs at the transcriptional level.
Furthermore, computational analysis of the DEFB1 promoter revealed the presence of a GTTCC DNA binding site for the PAX2 transcriptional repressor next to the DEFB
box (Figure 1). The results presented here show that PAX2 and DEFB1 exhibit several attributes of suitable cancer targets, including a role in the suppression of cell death.
Therefore, DEFB 1 plays a role in tumor immunity and its expression is modulated through therapeutic down-regulation of the PAX2 oncogene.
Materials and Methods RNA Isolation and Quantitative RT-PCR
In order to verify changes in DEFB1 expression levels RNA was collected after days of PAX2 siRNA treatment. Briefly, total RNA was isolated using the SV
Total RNA
Isolation System (Promega, Madison, WI) from approximately 1 x 106 cells harvested by trypsinizing. Here, cells were lysed and total RNA was isolated by centrifugation through spin columns. Total RNA (0.5 g per reaction) from both sources was reverse transcribed into cDNA utilizing random primers (Promega). AMV Reverse Transcriptase II
enzyme (500 units per reaction; Promega) was used for first strand synthesis and Tfl DNA
Polymerase for second strand synthesis (500 units per reaction; Promega) as per the manufacturer's protocol. In each case, 50 pg of cDNA was used per ensuing PCR
reaction.
Two-step QRT-PCR was performed on cDNA generated using the MultiScribe Reverse Transcripatase from the TaqMan Reverse Transcription System and the SYBR Green PCR
Master Mix (Applied Biosystems).
The primer pair for DEFB 1 was generated from the published DEFB1 sequence (Accession No. U50930). Forty cycles, of PCR were performed under standard conditions using an annealing temperature of 56 C. In addition, GAPDH was amplified as a housekeeping gene to normalize the initial content of total cDNA. DEFBl expression was calculated as the relative expression ratio between DEFB 1 and GAPDH and was compared in cells lines before and after siRNA knock-down of PAX2 expression. All reactions were run three times in triplicate.
Generation of the DEFBI Reporter Construct The pGL3 luciferase reporter plasmid was used to monitor DEFB1 reporter activity.
Here, a region 160 bases upstream of the DEFB1 transcription initiation site and included the DEFB1 TATA box. The region also included the GTTCC sequence which is necessary for PAX2 binding. The PCR primers were designed to contain Kpnl and Nhel restriction sites. The DEFB1 promoter PCR products were restriction digested Kpn I and NheI and ligated into a similary restriction digested pGL3 plasmid (Figure 2). The constructs were transfected into E. coli and individual clones were selected and expanded.
Plasmids were isolated and sequence integrity of the DEFB1/pGL3 construct was verified by automated sequencing.
Luciferase Reporter Assay Here, 1 g of the DEFBI reporter construct or the control pGL3 plasmid was transfected into 1x106 DU145 cells. Next, 0.5x103 cells were seeded onto each well of a 96-well plate and allowed to grow overnight. Then fresh medium was added containing PAX2 siRNA or media only and the cells were incubated for 48 hours. Luciferase was detected by the BrightGlo kit accourding to the manufacturer's protocol (Promega) and the plates were read on a Veritas automated 96-well luminometer. Promoter activity was expressed as relative luminescence.
Analysis of Membrane Permeability Acridine orange (AO)/ethidium bromide (EtBr) dual staining was performed to identify changes in cell membrane integrity, as well as apoptotic cells by staining the condensed chromatin. AO stains viable cells as well as early apoptotic ceHs, whereas EtBr stains late stage apoptotic cells that have lost membrane permeability.
Briefly, cells were seeded inta 2 chamber culture slides (BD Falcon, USA). Cells transfected with empty pIND plasmid/pvgRXR or pIND DEFB1/pvgRXR were induced for 24 or 48 h with media containing 10 M Ponasterone A. Control cells were provided fresh media at 24 and 48h.
In order to determine the effect of PAX2 inhibition on membrane integrity, separate culture slides containing DU145, PC3 and LNCaP were treated with PAX2 siRNA and incubated for 4 days. Following this, cells were washed once with PBS and stained with 2 ml of a mixture (1:1) of AO (Sigma, USA) and EtBr (Promega, USA) (5ug/ml) solution for 5 min.
Following staining, the cells were again washed with PBS. Fluorescence was viewed by a Zeiss LSM 5 Pascal Vario 2 Laser Scanning Confocal Microscope (Carl Zeiss Jena, Germany). The excitation color wheel contain BS505-530 (green) and LP560 (red) filter blocks which allowed for the separation of emitted green light from AO into the green channel and red light from EtBr into the red channel. The laser power output and gain control settings within each individual experiment were identical between control and DEFB1 induced cells. The excitation was provided by a Kr/Ar mixed gas laser at wavelengths of 543nm for AO and 488 nm for EtBr. Slides were analyzed under magnification and digital images were stored as uncompressed TIFF files and exported into Photoshop CS software (Adobe Systems, San Jose, CA) for image processing and hard copy presentation.
ChIP Analysis of PAX2 Chromatin immunoprecipitation (ChIP) allows the identification of binding sites for DNA-binding proteins based upon in vivo occupancy of a promoter by a transcription factor and enrichment of transcription factor bound chromatin by immunoprecipitation (66). A
modification of the protocol described by the Farnham laboratory ((67, 68) was used; also on line at http://mcardle.oncology.wisc.edu/farnham/). The DU145 and PC3 cell lines over-expresses the PAX2 protein, but does not express DEFB1. Cells were incubated with PBS
containing 1.0% formaldehyde for 10 minutes to crosslink proteins to DNA.
Samples were then sonicated to yield DNA with an average length of 600 bp. Sonicated chromatin precleared with Protein A Dynabeads was incubated with PAX2-specific antibody or "no antibody" control [isotype-matched control antibodies]. Washed immunoprecipitates were then collected. After reversal of the crosslinks, DNA was analyzed by PCR
using promoter-specific primers to determine whether DEFB1 is represented in the PAX2-immunoprecipitated. samples. Primers were designed to amplify the 160 bp region immediately upstream of the DEFB 1 mRNA start site which contained the DEFB 1 TATA
box and the functional GTTCC PAX2 recognition site. For these studies, positive controls included PCR of an aliquot of the input chromatin (prior to immunoprecipitation, but crosslinks reversed). All steps were perfonned in the presence of protease inhibitors.
Results siRNA Inhibition of PA.X2 Increases DEFB1 Expression QRT-PCR analysis of DEFB1 expression before siRNA treatment revealed relative expression levels of 0.00097 in DU145, 0.00001 in PC3, and .00004 LNCaP
(Figure 13).
Following siRNA knock-down of PAX2, relative expression was .03294 (338-fold increase) in DU145,.00020 (22.2-fold increase) in PC3 and 0.00019 (4.92-fold increase) in LNCaP.
As a negative control, the human prostate epithelial cell line (hPrEC) which is PAX2 null, revealed expression levels at 0.00687 before treatment and 0.00661 following siRNA
treatment confirming no statistical change in DEFB 1 expression.
DEFBI Causes Cell Membrane Permeability Membrane integrity was monitored by confocal analysis (Figure 14). Here, intact cells stain green due to AO which is membrane permeable. In addition, cells with compromised plasma membranes would stain red by EtBr which is membrane impermeable.
Here, uninduced DU145 (A) and PC3 (D) cells stained positively with AO and emitted green color, but did not stain with EtBr. However, DEFB1 induction in both DU145 (B) and PC3 (E) resulted in the accumulation of EtBr in the cytoplasm at 24 hours indicated by the red staining. By 48 hours, DU145 (C) and PC3 (F) possessed condensed nuclei and appeared yellow, which was due to the presence of both green and red staining resulting from the accumulation of AO and EtBr, respectively.
Inhibition of PAX2 Results in Membrane Pernaeability Cells were treated with PAX2 siRNA for 4 days and membrane integrity was monitored again by confocal analysis (Figure 15). Here, both DU145 (B) and PC3 (E) possessed condensed nuclei and appeared yellow. However, LNCaP cells' cytoplasm and nuclei remained green following siRNA treament. Also red staining at the cell periphery indicates the maintenance of cell membrane integrity. These findings indicate that the inhibition of PAX2 results in specifically DEFB 1 -mediated cell death in DU1145 and PC3, but not LNCaP cells. Death observed in LNCaP (refer to Chapter II) is due to the transactivation of the existing wild-type p53 in LNCap following PAX2 inhibition.
siRNA Inhibition of PAX2 Increases DEFB1 Promoter Activity Analysis of DEFB1 promoter activity in DU145 cells containing the DEFB1/pGL3 construct revealed a 2.65 fold increase in relative light units following 48 hours of treatment compared to untreated cells (Figure 16). In PC3 cells, there was a 3.78-fold increase in relative light units compared to untreated cells.
PAX2 Binds to the DEFBI Promoter ChIP analysis was performed on DU145 and PC3 cells to determine if the PAX2 transcriptional repressor is bound to the DEFB1 promoter (Figure 17). Lane 1 contains a 100 bp molecular weight marker. Lane 2 is a positive control representing 160 bp region of the DEFBl promoter amplified from DU145 before cross-linking and immunoprecipitation.
Lane 3 is a negative control representing PCR performed without DNA. Lane 4 and 5 are negative controls representing PCR from immunoprecipitations performed with IgG from cross-linked DU145 and PC3, respectively. PCR amplification of 25pg of DNA
(lane 6 and 8) and 50pg of DNA (lane 7 and 9) immunoprecitipated with anti-PAX2 antibody after crosslinking show 160 bp promoter fragment in DU145 and PC3, respectively.
Conclusion The present novel data are the first to disclose the role of DEFB 1 in prostate cancer tumor inununity. The data also show that the oncogenic factor PAX2 suppresses expression. One of the hallmarks of defensin cytotoxicity is the disruption of membrane integrity. The present results show that ectopic expression of DEFB1 in prostate cancer cells results in a loss of membrane potential due to compromised cell membranes. The same phenomenon is observed after inhibiting PAX2 protein expression. ChIP
analysis was also performed and confirmed that PAX2 is bound to the DEFB1 promoter resulting in the repression of DEFB 1 expression. Therefore, suppression of PAX2 expression or function, results in the re-establishment of DEFB 1 expression and subsequently DEFB 1-mediated cell death. Also, the present data establish the utility of DEFB 1 as a directed therapy for prostate cancer treatment through innate immunity.
Example IV
Expression of DEFB1 Results in Tumor Shrinkage The anti-tumoral ability of DEFB1 is evaluated by injecting tumor cells that overexpress DEFB1 into nude mice. DEFBl is cloned into pBI-EGFP vector, which has a bidirectional tetracycline responsible promoter. Tet-Off Cell lines are generated by transfecting pTet-Off into DU145, PC3 and LNCaP cells and selecting with G418.
The pBI-EGFP-DEFB 1 plasmid is co-transfected with pTK-Hyg into the Tet-off cell lines and selected with hygromycin. Only single-cell suspensions with a viability of >90% are used.
Each animal receives approximately 500,000 cells administered subcutaneously into the right flank of female nude mice. There are two groups, a control group injected with vector only clones and a group injected with the DEFB1 over-expressing clones. 35 mice are in each group as determined by a statistician. Animals are weighed twice weekly, tumor growth monitored by calipers and tumor volumes determined using the following formula:
volume = 0.5 x (width)2 x length. All animals are sacrificed by CO2 overdose when tumor size reaches 2 mm3 or 6 months following implantation; tumors are excised, weighed and stored in neutral buffered formalin for pathological examination. Differences in tumor growth between the groups are descriptively characterized through summary statistics and graphical displays. Statistical significance is evaluated with either the t-test or non-parametric equivalent.
Example V
Expression of PAX2 siRNA Results in Up-Regulation of DEFB1 Expression and Tumor Shrinkage In Vivo Hairpin PAX2 siRNA template oligonucleotides utilized in the in vitro studies are utilized to examine the effect of the up-regulation of DEFB 1 expression in vivo. The sense and antisense strand (see Table 4) are annealed and cloned into pSilencer 2.1 U6 hygro siRNA expression vector (Ambion) under the control of the human U6 RNA pol III
promoter. The cloned plasmid is sequenced, verified and transfected into PC3, Du145, and LNCap cell lines. Scrambled shRNA is cloned and used as a negative control in this study.
Hy.gromycin resistant colonies are selected, cells are introduced into the mice subcutaneously and tumor growth is monitored as described above.
Example VI
Small Molecule Inhibitors of PAX2 Binding Results in Up-Regulation of DEFB1 Expression and Tumor Shrinkage In Vivo The DNA recognition sequence for PAX2 binding resides in the DEFB1 promoter between nucleotides -75 and -71 [+1 refers to the transcriptional start site].
Short oligonucleotides complementary to the PAX2 DNA-binding domain are provided.
Examples of such oligonucleotides include the 20-mer and 40-mer oligonucleotides containing the GTTCC recognition sequence provided below. These lengths were randomly selected, and other lengths are expected to be effective as blockers of binding. As a negative control, oligonicleotides with a scrambled sequence (CTCTG) were designed to verify specificity. The oligonucleotides are transfected into the prostate cancer cells and the HPrEC cells with lipofectamine reagent or Codebreaker transfection reagent (Promega, Inc). In order to confirm DNA-protein interactions, double stranded oligonucleotides will be labeled with [32P] dCTP and electrophoretic mobility shift assays are performed. In addition, DEFB1 expression is monitored by QRT-PCR and Western analysis following treatment with oligonucleotides. Finally, cell death is detected by MTT assay and flow cytometry as previously described.
Recognition Sequence #1: CTCCCTTCAGTTCCGTCGAC (SEQ ID NO:9) Recognition Sequence #2: CTCCCTTCACCTTGGTCGAC (SEQ IDNO:10) Scramble Sequence #1: CTCCCTTCACTCTGGTCGAC (SEQ ID NO:11) Recognition Sequence #3:
ACTGTGGCACCTCCCTTCAGTTCCGTCGACGAGGTTGTGC (SEQ ID NO: 12) Recognition Sequence #4:
ACTGTGGCACCTCCCTTCACCTTGGTCGACGAGGTTGTGC (SEQ ID NO: 13) Scramble Sequence #2:
ACTGTGGCACCTCCCTTCACTCTGGTCGACGAGGTTGTGC (SEQ ID NO: 14) Further examples of oligonucleotides of the invention include:
Recognition Sequence #1: 5'-AGAAGTTCACCCTTGACTGT-3' (SEQ ID No:x) Recognition Sequence #2: 5'-AGAAGTTCACGTTCCACTGT-3' (SEQ ID No:x) Scramble Sequence #1: 5'-AGAAGTTCACGCTCTACTGT-3' (SEQ ID No:x) Recognition Sequence #3:
5'-TTAGCGATTAGAAGTTCACCCTTGACTGTGGCACCTCCC-3' (SEQ ID No:x) Recognition Sequence #4:
5'-GTTAGCGATTAGAAGTTCACGTTCCACTGTGGCACCTCCC-3' (SEQ ID No:x) Scramble Sequence #2:
5'-GTTAGCGATTAGAAGTTCACGCTCTACTGTGGCACCTCCC-3' (SEQ ID No:x) This set of alternative inhibitory oligonucleotides represents the recognition sequence (along with the CCTTG core sequence) for the PAX2 binding domain and homeobox. These include actual sequences from the DEFB1 promoter.
The PAX2 gene is required for the growth and survival of various cancer cells including prostate. In addition, the inhibition of PAX2 expression results in cell death mediated by the innate immunity component DEFB 1. Suppression of DEFB 1 expression and activity is accomplished by binding of the PAX2 protein to a GTTCC
recognition site in the DEFB 1 promoter. Therefore, this pathway provides a viable therapeutic target for the treatment of prostate cancer. In this method, the sequences bind to the PAX2 DNA binding site and block PAX2 binding to the DEFB 1 promoter thus allowing DEFB 1 expression and activity. The oligonucleotide sequences and experiment described above are examples of and demonstrate a model for the design of additional PAX2 inhibitor drugs.
Given that the GTTCC sequence exists in interleukin-3, interleukin-4, the insulin receptor and others, PAX2 regulates their expression and activity as well. Therefore the PAX2 inhibitors disclosed herein have utility in a number of other diseases including those directed related to inflaxmllation including prostatitis and benign prostatic hypertrophy (BPH).
Example VII
Loss of DEFB1 Expression Results in Increased Tumorigenesis Generation of Loss of Function Mice The Cre/loxP system has been useful in elucidating the molecular mechanisms underlying prostate carcinogenesis. Here a DEFB1 Cre conditional KO is used for inducible disruption within the prostate. The DEFB 1 Cre conditional KO involves the generation of a targeting vector containing loxP sites flanking DEFB 1 coding exons, targeted ES cells with this vector and the generation of germline chimeric mice from these targeted ES
cells.
Heterozygotes are mated to prostate-specific Cre transgenics and heterozygous intercross is used to generate prostate-specific DEFB 1 KO mice. Four genotoxic chemical compounds have been found to induce prostate carcinomas in rodents: N-methyl-N-nitrosourea (MNLT), N-nitrosobis 2-oxopropyl. amine (BOP), 3,2X-dimethyl-4-amino-biphenyl (MAB) and 2-amino-1 -methyl-6-plienylimidazow 4,5-bxpyridine (PhIP). DEFB1-transgenic mice are treated with these carcinogenic compounds via intra-gastric administration or i.v. injection for prostate adenoma and adenocarcinoma induction studies. Prostate samples are studied for differences in tumor growth and changes gene expression though histological, immunohistological, mRNA and protein analyses.
Generation of GOF mice For PAX2 inducible GOF mice, PAX2 GOF (bi-transgenic) and wild-type (mono-transgenic) littermates are administered doxycycline (Dox) from 5 weeks of age to induce prostate-specific PAX2 expression. Briefly, PROBASIN-rtTA mono-transgenic mice (prostate cell-specific expression of tet-dependent rtTA inducer) are crossed to our PAX2 transgenic responder lines. For induction, bi-transgenic mice are fed Dox via the drinking water (500 mg/L freshly prepared twice a week). Initial experiments verify low background levels, good inducibility and cell-type specific expression of PAX2 and the EGFP reporter using transgenic founder line in bi-transgenic mice. Regarding experimental group sizes, 5-7 age- and sex-matched individuals in each group (wild-type and GOF) allow for statistical significance. For all animals in this study, prostate tissues are collected initially at weekly intervals for analysis and comparison, to determine carcinogenic time parameters.
PCR Genotyping, RT-PCR and qPCR
PROBASIN-rtTA transgenic mice are genotyped using the following PCR primers and conditions: PROBASIN5 (forward) 5'-ACTGCCCATTGCCCAAACAC-3'; RTTA3 (reverse) 5'-AAAATCTTGCCAGCTTTCCCC-3'; 95 C denaturation for 5 min, followed by 30cycles of 95 C for 30 sec, 57 C for 30 sec, 72 C for 30 sec, followed by a 5 min extension at 72 C, yielding a 600 bp product. PAX2 inducible transgenic mice are genotyped using the 'following PCR primers and conditions: PAX2For 5'-GTCGGTTACGGAGCGGACCGGAG-3'; Rev5'1RES 5'-TAACATATAGACAAACGCACACCG-3'; 95 C denaturation for 5 min, followed by 34cycles of 95 C for 30 sec, 63 C for 30 sec, 72 C for 30 sec, followed by a 5 min extension at 72 C, yielding a 460 bp product. Immortomouse hemizygotes are be genotyped using the following PCR primers and conditions: hnmoll, 5'-GCGCTTGTGTC
GCCATTGTATTC-3'; Iinmol2, 5'-GTCACACCACAGAAGTAAGGTTCC-3'; 94 C 30 sec, 58 C 1 min, 72 C lmin 30 sec, 30 cycles to yield a-lkb transgene band.
For genotyping PAX2 knockout mice, the following PCR primers and conditions are used:
PAX2 For 5'-GTCGGTTACGGAGCGGACCGGAG-3'; PAX2Rev 5'-CACAGAGCATTGGCGATCTCGATGC-3'; 94 C 1 min, 65 C 1 min, 72 C 30 sec, 36 cycles to yield a 280 bp band.
DEFBI Peptide Aninaal Studies Six-week-old male athymic (nude) mice purchased from Charles River Laboratories are injected sub-cutaneously over the scapula with 106 viable PC3 cells. One week after injection, the animals are randomly allocated to one of three groups -group I:
control; group II: intraperitoneal injections of DEFB1, 100 g/day, 5 days a week, for weeks 2-14; group III: intraperitoneal injections of DEFB1, 100 mg/day, 5 days a week, for weeks 8-14.
Animals are maintained in sterile housing, four animals to a cage, and observed on a daily basis. At 10-day intervals, the tumors are measured by using calipers, and the volumes of the tumors are calculated by using V(L x W2)/2.
Appendix A
LOCUS HUMPAX201 7331 bp DNA linear PRI 28-JAN-2002 DEFINITION Homo sapiens paired-box protein (PAX2) gene, promoter and exon 1.
VERSION L09748.2 GI:18141563 KEYWORDS .
SEGMENT 1 of 3 SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Catarrhini;
Hominidae; Homo.
REFERENCE 1 (bases 7096 to 7291) AUTHORS Stapleton,P., Weith,A., Urbanek,P., Kozmik,Z. and Busslinger,M.
TITLE Chromosomal localization of seven PAX genes and cloning of a novel family member, PAX-9 JOURNAL Nat. Genet. 3(4), 292-298 (1993) REFERENCE 2(bases 1 to 7331) AUTHORS Pfeffer,P.L., Payer,B., Reim,G., di Magliano,M.P. and Busslinger,M.
TITLE The activation and maintenance of Pax2 expression at the mid-hindbrain boundary is controlled by separate enhancers JOURNAL Development 129 (2), 307-318 (2002) REFERENCE 3 (bases 7096 to 7291) AUTHORS Stapleton,P., Weith,A., Urbanek,P., Kozmik,Z. and Busslinger,M.
TITLE Direct Submission JOURNAL Submitted (12-JLTN-1993) Research Institute of Molecular Pathology, Dr. Bohr-Gasse 7, Vienna, Austria REFERENCE 4 (bases 1 to 7331) AUTHORS Pfeffer,P.L. and Busslinger,M.
TITLE Direct Submission JOURNAL Submitted (14-JAN-2002) Research Institute of Molecular Pathology, Dr. Bohr-Gasse 7, Vienna, Austria REIVIARK Sequence update by submitter COMMENT On Jan 14, 2002 this sequence version replaced gi:292378.
FEATURES Location/Qualifiers source 1..7331 /organism="Homo sapiens"
/mo1_type="genomic DNA"
/dbxref--"taxon:9606"
/chromosome=" 10"
/map=" 10q22.1-q24.3"
gene order(2034..7331,L09746.1:1..206,L09747.1:1..>238) /gene="PAX2"
enhancer 2034..2518 /gene="PAX2"
/note="distal (late) enhancer"
enhancer 2850..2974 /gene="PAX2"
/note="intermediate (early) enhancer"
enhancer 3516..3898 /gene="PAX2"
/note="proximal (late) enhancer"
mRNA join(6532..7271,L09746.1:21..186,L09747.1:21.>218) /gene="PAX2"
/product="paired-box protein"
exon 6532..7271 /gene="PAX2"
/numbeY=1 CDS join(7229..7271,L09746.1:21..186,L09747.1:21..>218) /gene="PAX2"
/codon_start=1 /product="paired-box protein"
/protein_id="AAC41711.1 "
/db xref--"GI:553607"
/translation="NIDMHCKADPFSAIVIHRHGGVNQLGGVFVNGRPLPDV VRQRIVELA
HQGVRPCDISRQLRV SHGCV SKILGRYYETGSIKPGV IGGSKPKVATPKV VDKIAEY
KRQNPTMFAWEIRDRLLAEGICDNDTVPSVS SIN"
ORIGIN
1 ttcccccttt ccangagggc ctaatccgtt gcgcgcgcgc acgcggacac acacacacac 61 acacacacac acacacacac acacacggcc cccatagcca ccgcaactct cagcagcagn 121 ncctagctcc tctgacccga ggccccaaga cggcgggcac aggaacccct gggacgtcct 181 ggctccaggc tggacgtagg cggaggtggc aggagtggac aaacccaggc gggtcccacg 241 acgccccttt cctcgggtct ctccttgttt cagccagccg ctctcgcccc tggtcccctc 301 ttccctgcgt tagggtcctt tgtctccagc cacctcgcag cctgtccccg cctcggcggc 361 cctgcccttt gggcctccca gatctctctg gcgggtcccc ctgccttacc agctcccggc 421 tgtggcgcgc tcttcgcctg ctcctcacat ncacacagct gctgggagag gaggaaggaa 481 aggcggncgc gccgcggatg gatccgagac ggtagatttg gtgccggctc gcaaactctg 541 ggaaacttaa ngccggttct tccgcccctc tncaactatg nccagcgcgg cccggtcgcg 601 cgcgctcacc ccgcggggac cctttccttt tcctgtattt cggctgcggc tgtttcgctt 661 cctctggtct cccagccttt ggagtggctt ccctggccct gcactccgtt ccctttcggc 721 cgcccccggc tgtcgcctgc ccccaccctc cgcaggtccc acggtcgcgg cggcgatgac 781 tgtggaggta acgccgggga cgtcctgggt cagcctgcac cgtctccctc gaccacagcc 841 cgatgaggcc gcgggctccg ggccggctgc taagagagtt aatcattact tcgccagcga 901 cactcagcct ccccttccga ctctctcgcc cggcctaggg gaggagggga ggggacagct 961 ggccaggtgg ggacttcggc ttcgcacaaa ccagcctctt caggcctccc agagacaggt 1021 ggtggcttct cagttccctc ggcaactctc taaggtcctc tttcttcccc tcctgtctct 1081 ccctccttcg agcctcctcc cagccaggcc tctccccacc gtctcctgtc cgctctggct 1141 ttgactgatt aactgcaggt cctgggagaa ccaactttct ttgtttggaa ccggaccgga 1201 cgggatttcc ttccctaggt ctccgccaat gggccagctc ctcccgacgg ttttggcgga 1261 ctggctgaag aggaccgcgc ctgaggccac aattaacccg gctgttggtg gtggtggttg 1321 gggggtgggc agtgaggaat ttaaccgatc ctctagcagc tgcgctggtg cagttgggag 1381 gggggtgcag gaagtgggaa tggaggagtg gcaggaggta tagacagagg gaagaacgat 1441 aaacctggac aggtgtggca tagccaatag aaggggaaac aaaataaaac aggaaggcgg 1501 cgcggggagg aatccccagt aacctttata ggattgaagt tgggtggaaa acgccacctc 1561 ctgccctacc ttagcactca gatccctcct ttacctcttt gtgaaagggt aagagttcag 1621 aaagctggcc atttactcca taatctacta gagaaatgtc tgggtttgca aaatgcctat 1681 tgattagctc catggagtag acaagacagg cgtaattatc cccattttac aggtgagaaa 1741 actgagtctc aaagaagcaa agggactgtg tatgtagtgg ctgtcacttt ttcctgtagg 1801 ctgtggggtg agtggcccct ttagctgtgc agaggtccat gggtatctag ggaggcggta 1861 caggctgtgt ccaggtctga gccagaagta ccagggcctc acggggctcc tagccctttt 1921 agcttgttct ctgttggaca ggaccttcac tcttactctc tagacctgct ggctgggttt 1981 ctcccagctt cgctattttt tcagttccct agtagagtgg cccatgggcg gtagccacct 2041 ggctggcccg tgccactaag aggcagcttt ggtggccaag tggcttgcat tgttgttgct 2101 cctcaaaggg cctgtgaagg gctgggcagg tcgcaaagac ctcttgtgag gggaaagcta 2161 gattaaaggg ggtaaggatc ctggaggata aaggccaagc acgtgcgcct ggactccaca 2221 ggaccaacag accgagcggg cggggccngc tgggagtcag gccccccggg cttcacgcag 2281 ggagcccaaa tattgggaac aaaagcagga aaagaagagt gagagcagga gggagggagg 2341 gagcgaggaa gcagaaatta gggggtctta gatgaaaaaa aaaagaaagt agctttaggg 2401 ggaatgtgct gtggagtgtg aaattgcagc ccatggtgct ccatattgta ccagaagctc 2461 ttccaaaaaa aaaaaaaaaa accatcctcc aacgtgacca gagggccagg cagggggaag.
2521 ggcggggaga gaatggggag gaggaggggg aaaggccggg caggagccgg tcaggccttt 2581 ctgcggaagg ggctggggtg taagtttcgg ctccctggga tctgacagcc gagggtatgc 2641 gccctggggt gcgccgggac ccagagggcg agtgagcctc ggttggtcgg ctctggagtt 2701 cggttgtcag aagaactttt atttttcttt ttggtggtga cttctaaaag tgggaataat 2761 ccagaaatga agctcagctg cggagctgca gctctgttct ccctctctcc cctgcctttc 2821 tgcttctctt cccttcggac tacttttctc cccttggttc taaatagctt tttcccctct 2881 gaactttaat gcatttaatt tggtccgcgc tgtggggagc atttcctggg gagatgcatt 2941 taatttcgga atttctaatc ccctccctca gaccccggtc ctagctcccc tagccgctcc 3001 ccgggaagtg gaaggaggaa ggcaggtccc ggccacgggg gaggggcgcg gctgggatgc 3061 tcccgcggcc ccctccgtct caccaaggct cagccgcctt cccaagctac tggaggccgg 3121 gcgcctgggc cccgggtcag ggccctgcan gaagaagaga ggcaaccccc gctttctgcc 3181 ttttcttcgc ctgggcaaga aaacgctggg ccagggaact ggaaaccgga aaacaggaga 3241 aagggtttnt ggaaggcanc gggagcgggt ggcagncggg gcancgggca ntggactagg 3301 tctacaccgg cacttcactt ttgcacaaca tgcccagaaa cgcatttgag agccctggag 3361 tcgcgcttgg cttggcttgg ggcgccggtg cgtgggtaca ctcgaggtcg gggtgcctat 3421 ccgccacccc gacacctaca cccagtgcag agcaggcgcg gcccagccag acaaccaggc 3481 cggcagtagc tcggcctgga gggcggaggc aaggttgggg gccgccaggc gcctgggcaa 3541 gcctggcagg gaagggagcc gagaaggcaa aggagccgag atccacaagg aagattnntt 3601 gggcagatca gatgcacaga ggcggctaat gaagcaaatc ccgagatggg tttcagagca 3661 actccccaaa agtttatttt gcctttaaat ttccgcaggg aggcgggctc cttgtttgaa 3721 gtgtaaatgc ccctaggttg gggggtggaa gggccgcttt gaaaacacca gagagaaaag 3781 gttcatttag aggcggacgg gaaaagcaac caaccctgac aggtcggagc ccgggtagtg 3841 tttggggttg ggtngttttc tttctttctc tttcttttcc cctttcctct tctttcttcc 3901 cttttgtgnn ttttnnttgt tttttttntn ttntttttnt ttaantggct ttcttgcttc ,3961 cccccacccc tctactagac tctatagaag aaagagaaca gaaaaggggg agtcagagga 4021 gcggccagtg actggatgaa ggccagccct tcatcctgga gccccaggag aaggcagagc 4081 tttggagaaa aggggttcct aatctccagg gagcattact ctttgactct ctagacccag 4141 gaatgggctg gacgctaatg gggaagcggc caggaacccg gcctggcgga agagtgagtg 4201 tccagctagt gcagtgctgg gaagacgatc ccaggagcag gggggactct caggggctac 4261 ctgggaatgg gactatcaga agggtcttta ctcctcanaa ggtgcatgtg aaggacaggt 4321 gtgtgaggac aacttccagc acacttggcg cattaagtcc ccttctctac aaaatggaaa 4381 atccttctcg cccaacatgt gaaaatgctt gttgtgggca cccacatttc atggtacttg 4441 taacatagga catgtctagc tggttctaga aaaatctgtg tctgtgtgga aggggggggg 4501 tttactcaca gctttcttcc ttcaatagtt cacacacccc gagacaaatt cctggatgac 4561 caacttggag agacctgggg caaaggttac tttagttctg agctcctcta aataaggacc 4621 ctttctcaac gttcctttca ccccagttct gggttaatta cttccagtta gtgcgtgttc 4681 gtggggttgt gaggccaaag caaacccggg agcgccatct gcaggcctca agaggaagag 4741 actgacctta gaggctaggc cctgcgtctt caacctctag cccaagggaa ccaacctgcc 4801 tagccaccca agggaagtgg gataggggct gggaggggca ggcggtgagg agtgttttcc 4861 tcccagactt taccccgcag gtggattaag cttattgggc tctggaggat acaggaggga 4921 gggcaaatgc caggatccca gcggacccag gccccacagg agtgagaggc tcagaacctc 4981 gtcccgctga gcctggcctg agctcctcct gaggaataag ggcatcccaa aaacccgggt 5041 acaagacgcc cagtagtagt agttaggctg agtcaggcag gtgcatctct ccccatggta 5101 tctgccgccc aggctccggc cagagggagg ggagcgcgag tccgcggcgc ttccgcgggg 5161 cgcccggaac tgcagacggg ggctggagga atctcggatt cgggctgcaa gagcgctgcg 5221 caagcttcgc cgagccgccc tttcgcagac ccagggaagc ggggggaggg agcgaaggag 5281 ggagagagag ttaaaacatc agcttgaaag tgcccaagat gattttatta agaccgaggg 5341 gaaaattatt ttcatgaaag attctccccg gaatatttct tgtacttaac ccagttagga 5401 agacaaaggg cttctttctg cctggtgcgg tgcgagcgga ccccagcgag caagggagct 5461 agtgccaaag agaactgcgg aggctccggc aggagtgggg acgtccccgt ggttgcgcct 5521 cctgcgctcg ccccggatcc accgagctag cagcgggcgg cgctcagccg cgtccgcagc 5581 ctcctcttct ccccagccgg ggagagccag cctcgtctcc cacatcctct gccgccagcg 5641 acctgcagct ccgcactgtt tccctcccct gtaccccctt cccagtcacc cgagggttca 5701 gaaaccaagt cccccggctc tcccgccatc cgctgggtcc caccgaggca ggtgggtact 5761 cgccggaggt cttcagctcg attctgaacc aagcgttctg gactgcccag acccggtggg 5821 caaggggact ggggaggccc tgcgcacagt cgcgtggaac gggaggggac aagacaaact 5881 gctggacact tttccgtgga atgagaagtg gggggtgcgt gggtgggaag gtacctccgg 5941 agggaaaggc caaagggaag gaccagaaag agaggaagga agagccggga aggaacggaa 6001 gggaactcag agccgagggt ggtggggttg gggctaggga tgcgcactgg gcccggggcc 6061 gcgcggccca ggcgggcact ggccagtgga tggcagggct gggcgagtta gaactgagag 6121 cccggcttca cagcgcagcg cgctccgagg ccctctgtcg ttacctgaat attcattaga 6181 ctgaccgctc tttatcctta tctaacgttt atcttatcgg cgagtttcgt ttctcagtgt 6241 agttttaatc ccgggctccc attccccctc ccccggtccg ctcccctccc tccctcttcc 6301 ttcgccggct gctccctccc tccctccctc ccatttctcc ctcccctgcc ctccccttgc 6361 cggcaccgga gtgacaggct cggggccctc ctcgccgaag ctcggggctc cagcgctggc 6421 gaatcacaga gtggtggaat ctattgcctt tgtctgacaa gtcatccatc tcccggcgcg 6481 gggaggggga ggaggtctgg agggggcttt gcagctttta gagagacaca caccgggagc 6541 cgaggctcca gtctccggcc gagtcttcta gcagccgcaa cccacctggg gccagcccag 6601 agctgccagc gccgctcggc tccctccctc cctcccggcc cttcggccgc ggcggcgtgc 6661 gcctgccttt tccgggggcg ggggcctggc ccgcgcgctc ccctcccgca ggcgccacct 6721 cggacatccc cgggattgct acttctctgc caacttcgcc aactcgccag cacttggaga 6781 ggcccggctc ccctcccggc gccctctgac cgcccccgcc ccgcgcgctc tccgaccacc 6841 gcctctcgga tgaacaggtt ccaggggagc tgagcgagtc gcctcccccg cccagcttca 6901 gccctggctg cagctgcagc gcgagccatg cgcccccagt gcaccccggc ccggcccacc 6961 gccccggggc cattctgctg accgcccagc cccgagcccc gacagtggca agttgcggct 7021 actgcggttg caagctccgg ccaacccgga ggagccccag cggggagcgc agtgttgcgc 7081 cccccgcccc cgcgcgcgcc gcagcagccg ggcgttcact catcctccct cccccaccgt 7141 ccctcccttt tctcctcaag tcctgaagtt gagtttgaga ggcgacacgg cggcggcggc 7201 cgcgctgctc ccgctcctct gcctccccat ggatatgcac tgcaaagcag accccttctc 7261 cgcgatgcac cgtgagtacc cgcgcccggc tcctgtcccg gctcgggctc tccgtcccaa 7321 ccctgtccag t Appendix B
LOCUS NM_003987 4276 bp mRNA linear PRI 24-SEP-2005 DEFINITION Homo sapiens paired box gene 2 (PAX2), transcript variant a, mRNA.
ACCESSION NM_003987 VERSION NM_003987.2 GI:34878698 KEYWORDS .
SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Catarrhini;
Hominidae; Homo.
REFERENCE 1(bases 1 to 4276) AUTHORS Yoshimura,K., Yoshida,S., Yamaji,Y., Komori,A., Yoshida,A., Hatae,K., Kubota,T. and Ishibashi,T.
TITLE De novo insG619 mutation in PAX2 gene in a Japanese patient with papillorenal syndrome JOURNAL Am. J. Ophthalmol. 139 (4), 733-735 (2005) REMARK GeneRIF: Molecular genetic analysis of the PAX2 gene in combination with renal ultrasonography can help in making an earlier diagnosis of the disease.
REFERENCE 2 (bases 1 to 4276) AUTHORS Mazal,P.R., Stichenwirth,M., Koller,A., Blach,S., Haitel,A. and Susani,M.
TITLE Expression of aquaporins and PAX-2 compared to CD 10 and cytokeratin 7 in renal neoplasms: a tissue microarray study JOU.RNAL Mod. Pathol. 18 (4), 535-540 (2005) REMARK GeneRIF: PAX-2 is a reliable marker for clear cell renal cell carcinomas of lower grades but not for higher grades.
REFERENCE 3 (bases 1 to 4276) AUTHORS Higashide,T., Wada,T., Sakurai,M., Yokoyama,H. and Sugiyama,K.
TITLE Macular abnormalities and optic disk anomaly associated with a new PAX2 missense mutation JOURNAL Am. J. Ophthalmol. 139 (1), 203-205 (2005) REMARK GeneRIF: A new PAX2 missense mutation, R71T, may cause macular abnormalities in addition to anomalies of the optic disk and the kidney.
REFERENCE 4 (bases 1 to 4276) AUTHORS Buttiglieri,S., Deregibus,M.C., Bravo,S., Cassoni,P., Chiarle,R., Bussolati,B. and Camussi,G.
TITLE Role of Pax2 in apoptosis resistance and proinvasive phenotype of Kaposi's sarcoma cells JOURNAL J. Biol. Chem. 279 (6), 4136-4143 (2004) REMARK GeneRIF: expression of Pax2 by Kaposi's sarcoma cells correlated with an enhanced resistance against apoptotic signals and with the proinvasive phenotype REFERENCE 5 (bases 1 to 4276) AUTHORS Brophy,P.D., Lang,K.M. and Dressler,G.R.
TITLE The secreted frizzled related protein 2(SF.RP2) gene is a target of the Pax2 transcription factor JOURNAL J. Biol. Chem. 278 (52), 52401-52405 (2003) REMARK GeneRIF: Pax2 protein regulates expression of secreted frizzled related protein 2 REFERENCE 6 (bases 1 to 4276) AUTHORS Schimmenti,L.A., Manligas,G.S. and Sieving,P.A.
TITLE Optic nerve dysplasia and renal insufficiency in a family with a novel PAX2 mutation, Argl 15X: further ophthalmologic delineation of the renal-coloboma syndrome JOURNAL Ophthalmic Genet. 24 (4), 191-202 (2003) REMARK GeneRIF: PAX2 mutation is associated with Optic nerve dysplasia and renal insufficiency of the renal-coloboma syndrome REFERENCE 7 (bases 1 to 4276) AUTHORS Muratovska,A., Zhou,C., He,S., Goodyer,P. and Eccles,M.R.
TITLE Paired-Box genes are frequently expressed in cancer and often required for cancer cell survival JOURNAL Oncogene 22 (39), 7989-7997 (2003) REMARK GeneRIF: The PAX2 gene was frequently expressed in a panel of 406 common primary tumor tissues and endogenous PAX gene expression is often required for the growth and survival of cancer cells REFERENCE 8 (bases 1 to 4276) AUTHORS Gough,S.M., McDonald,lV1., Chen,X.N., Korenberg,J.R., Neri,A., Kahn,T., Eccles,M.R. and Morris,C.M.
TITLE Refined physical map of the human PAX2/HOX11/NFKB2 cancer gene region at 10q24 and relocalization of the HPV6AI1 viral integration site to 14q13.3-q21.1 JOURNAL BMC Genomics 4 (1), 9 (2003) REFERENCE 9 (bases 1 to 4276) AUTHORS Hoffineister,A., Ropolo,A., Vasseur,S., Mallo,G.V., Bodeker,H., Ritz-Laser,B., Dressler,G.R., Vaccaro,M.I., Dagorn,J.C., Moreno,S.
and Iovanna,J.L.
TITLE The HMG-UY-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter JOURNAL J. Biol. Chem. 277 (25), 22314-22319 (2002) E2EMARK GeneRIF: The HMG-UY-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter.
REFERENCE 10 (bases 1 to 4276) AUTHORS Cai,Y., Lechner,M.S., Nihalani,D., Prindle,M.J., Holzman,L.B. and Dressler,G.R.
TITLE Phosphorylation of Pax2 by the c-Jun N-terminal kinase and enhanced Pax2-dependent transcription activation JOURNAL J. Biol. Chem. 277 (2), 1217-1222 (2002) REFERENCE 11 (bases 1 to 4276) AUTHORS Becker,K., Beales,P.L., Calver,D.M., Matthijs,G. and Mohammed,S.N.
TITLE Okihiro syndrome and acro-renal-ocular syndrome: clinical overlap, expansion of the phenotype, and absence of PAX2 mutations in two new families JOURNAL J. Med. Genet. 39 (1), 68-71 (2002) REMARK GeneRIF: The absence of PAX2 mutations has been identified in two families with histories of clinical overlap of Okihiro and acro-renal-ocular syndromes.
REFERENCE 12 (bases 1 to 4276) AUTHORS Eccles,M.R., He,S., Legge,M., Kumar,R., Fox,J., Zhou,C., French,M.
and Tsai,R.W.
TITLE PAX genes in development, and disease: the role of PAX2 in urogenital tract development JOURNAL Int. J. Dev. Biol. 46 (4), 535-544 (2002) REMARK Review article GeneRIF: PAX2 has a role in urogenital tract development and disease [review]
REFERENCE 13 (bases 1 to 4276) AUTHORS Chung,G.W., Edwards,A.O., Schimmenti,L.A., Manligas,G.S., Zhang,Y.H. and Ritter,R. III.
TITLE Renal-coloboma syndrome: report of a novel PAX2 gene mutation JOURNAL Am. J. Ophthalmol. 132 (6), 910-914 (2001) REMARK GeneRIF: The causal relationship between PAX2 gene mutations and renal-coloboma syndrome is further supported REFERENCE 14 (bases 1 to 4276) AUTHORS Nishimoto,K., Iijima,K., Shirakawa,T., Kitagawa,K., Satomura,K., Nakamura,H. and Yoshikawa,N.
TITLE PAX2 gene mutation in a family with isolated renal hypoplasia JOURNAL J. Am. Soc. Nephrol. 12 (8), 1769-1772 (2001) REFERENCE 15 (bases 1 to 4276) AUTHORS Ritz-Laser,B., Estreicher,A., Gauthier,B. and Philippe,J.
TITLE The paired homeodomain transcription factor Pax-2 is expressed in the endocrine pancreas and transactivates the glucagon gene promoter JOURNAL J. Biol. Chem. 275 (42), 32708-32715 (2000) REFERENCE 16 (bases 1 to 4276) AUTHORS Lechner,M.S., Levitan,I. and Dressler,G.R.
TITLE PTIP, a novel BRCT domain-containing protein interacts with Pax2 and is associated with active chromatin JOURNAL Nucleic Acids Res. 28 (14), 2741-2751 (2000) REFERENCE 17 (bases 1 to 4276) AUTHORS Tavassoli,K., Ruger,W. and Horst,J.
TITLE Alternative splicing in PAX2 generates a new reading frame and an extended conserved coding region at the carboxy terminus JOURNAL Hum. Genet. 101 (3), 371-375 (1997) REFERENCE 18 (bases 1 to 4276) AUTHORS Dahl,E., Koseki,H. and Balling,R.
TITLE Pax genes and organogenesis JOURNAL Bioessays 19 (9), 755-765 (1997) RElVIARK Review article REFERENCE 19 (bases 1 to 4276) AUTHORS Schimmenti,L.A., Cunliffe,H.E:, McNoe,L.A., Ward,T.A., French,M.C., Shim,H.H., Zhang,Y.H., Proesmans,W., Leys,A., Byerly,K.A., Braddock,S.R., Masuno,M., Imaizumi,K., Devriendt,K. and Eccles,M.R.
TITLE Further delineation of renal-coloboma syndrome in patients with extreme variability of phenotype and identical PAX2 mutations JOURNAL Am. J. Hum. Genet. 60 (4), 869-878 (1997) REFERENCE 20 (bases 1 to 4276) AUTHORS Narahara,K., Baker,E., Ito,S., Yokoyama,Y., Yu,S., Hewitt,D., Sutherland,G.R., Eccles,M.R. and Richards,R.I.
TITLE Localisation of a 10q breakpoint within the PAX2 gene in a patient with a de novo t(10;13) translocation and optic nerve coloboma-renal disease JOURNAL J. Med. Genet. 34 (3), 213-216 (1997) REFERENCE 21 (bases 1 to 4276) AUTHORS Dehbi,M., Ghahremani,M., Lechner,M., Dressler,G. arid Pelletier,J.
TITLE The paired-box transcription factor, PAX2, positively modulates expression of the Wilms' tumor suppressor gene (WT1) JOURNAL Oncogene 13 (3), 447-453 (1996) REFERENCE 22 (bases 1 to 4276) AUTHORS Sanyanusin,P., Norrish,J.H., Ward,T.A., Nebel,A., McNoe,L.A. and Eccles,M.R.
TITLE Genomic structure of the human PAX2 gene JOURNAL Genomics 35 (1), 258-261 (1996) REFERENCE 23 (bases 1 to 4276) AUTHORS Sanyanusin,P., Schimmenti,L.A., McNoe,L.A., Ward,T.A., Pierpont,M.E., Sullivan,M.J., Dobyns,W.B. and Eccles,M.R.
TITLE Mutation of the PAX2 gene in a family with optic nerve colobomas, renal anomalies and vesicoureteral reflux JOURNAL Nat. Genet. 9(4), 358-364 (1995) REFERENCE 24 (bases 1 to 4276) AUTHORS Ward,T.A., Nebel,A., Reeve,A.E. and Eccles,M.R.
TITLE Alternative messenger RNA forms and open reading frames within an additional conserved region of the human PAX-2 gene JOURNAL Cell Growth Differ. 5(9), 1015-1021 (1994) REFERENCE 25 (bases 1 to 4276) AUTHORS Noll,M.
TITLE Evolution and role of Pax genes JOURNAL Curr. Opin. Genet. Dev. 3(4), 595-605 (1993) RElVIARK Review article REFERENCE 26 (bases 1 to 4276) AUTHORS Stapleton,P., Weith,A., Urbanek,P., Kozmik,Z. and Busslinger,M.
TITLE Chromosomal localization of seven PAX genes and cloning of a novel family member, PAX-9 JOURNAL Nat. Genet. 3 (4), 292-298 (1993) REFERENCE 27 (bases 1 to 4276) AUTHORS Pilz,A.J., Povey,S., Gruss,P. and Abbott,C.M.
TITLE Mapping of the human homologs of the murine paired-box-containing genes JOURNAL Marnm. Genome 4 (2), 78-82 (1993) REFERENCE 28 (bases 1 to 4276) AUTHORS Eccles,M.R., Wallis,L.J., Fidler,A.E., Spurr,N.K., Goodfellow,P.J.
and Reeve,A.E.
TITLE Expression of the PAX2 gene in human fetal kidney and Wi1ms' tumor JOURNAL Cell Growth Differ. 3(5), 279-289 (1992) COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from U45255.1 and BM671839.1.
On Sep 22, 2003 this sequence version replaced gi:4557822.
Summary: PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1.
Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.
Transcript Variant: This variant (a) uses an alternate in-frame splice site in the 3' coding region, compared to variant e, resulting in a shorter protein (isoform a) that has a shorter, distinct C-terminus compared to isoform e.
COMPLETENESS: complete on the 3' end.
FEATURES Location/Qualifiers source 1..4276 /organism="Homo sapiens"
/mol_type="mRNA"
/db_xref-~"taxon:9606"
/chromosome=" 10"
/map=" 10c124"
gene 1..4276 /gene="PAX2"
/dbxref--"GeneID : 5 076"
/db_xref--"HGNC:8616"
/db_xref--"MIM:167409"
CDS 687..1937 /gene="PAX2"
/note="PAX2 gene is- a member of the paired-box containing genes which encode transcription factors involved in embryonic and fetal development; the gene product is nuclear protein which binds DNA
isoform a is encoded by transcript variant a; paired box homeotic gene 2;
go_component: nucleus [goid 0005634] [evidence IEA];
go_function: ATP binding [goid 0005524] [evidence IEA];
go_function: DNA binding [goid 0003677] [evidence IEA];
go_function: DNA binding [goid 0003677] [evidence TAS]
[pmid 9106533];
go_function: nucleoside diphosphate kinase activity [goid 0004550] [evidence IEA];
go_process: development [goid 0007275] [evidence IEA];
go_process: transcription [goid 0006350] [evidence IEA];
go_process: CTP biosynthesis [goid 0006241] [evidence IEA];
go_process: GTP biosynthesis [goid 0006183] [evidence IEA];
go_process: UTP biosynthesis [goid 0006228] [evidence IEA];
go_process: axonogenesis [goid 0007409] [evidence TAS]
[pmid 9106533];
go_process: cell differentiation [goid 0030154] [evidence lEA];
go_process: visual perception [goid 0007601] [evidence TAS] [pmid 9106533];
go_process: regulation of transcription, DNA-dependent [goid 0006355] [evidence IEA];
go_process: transcription from RNA polymerase II promoter [goid 0006366] [evidence TAS] [pmid 8760285]"
/codon_start=l /product="paired box protein 2 isoform a"
/protein_id="NP_003978.2"
/dbxref="GI:34878699"
/db_xref--"GeneID: 5 076"
/dbxref--"HGNC:8616"
/db xref-'-"MINI:167409"
/translation="MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPD V VRQRIVELAH
QGVRPCDISRQLRV SHGC V SKILGRYYETGSIIKPGVIGGSKPKVATPKV VDKIAEYK
RQNPTMFAWEIRDRLLAEGICDNDTVPS VS SINRIIRTKVQQPFHPTPDGAGTGVTA
PGHTIVPSTASPPV SSASNDPVGSYSINGILGIPRSNGEKRKRDEVEVYTDPAHIRGG
GGLHLVWTLRDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSY
PDVFQASEHIKSEQGNEYS LPALTPGLDEVKS SLSASTNPELGSNVS GTQTYPV VTG
RDMASTTLPGYPPHVPPTGQGSYPTSTLAGMVPGSEFSGNPYSHPQYTAYNEAWRF
SNPALL
SSPYYYSAAPRSAPAAAAAAYDRH"
STS 1926..2132 /gene="PAX2"
/standardname="R.H80285"
/db_xref--"UniSTS :88437"
STS 3124..3276 /gene="PAX2"
/standardname="D 10S2478"
/db_xref="UniSTS:74159"
polyA signal 4230..4235 /gene="PAX2"
polyA_signal 4234..4239 /gene="PAX2"
polyA signal 4241..4246 /gene="PAX2"
polyA site 4259 /gene="PAX2"
ORIGIN
1 aggctccagt ctccggccga gtcttctcgc agccgcaacc cacctggggc cagcccagag 61 ctgccagcgc cgctcggctc cctccctccc tcccggccct tcggccgcgg cggcgtgcgc 121 ctgccttttc cgggggcggg ggcctggccc gcgcgctccc ctcccgcagg cgccacctcg 181 gacatccccg ggattgctac ttctctgcca acttcgccaa ctcgccagca cttggagagg 241 cccggctccc ctcccggcgc cctctgaccg cccccgcccc gcgcgctctc cgaccaccgc 301 ctctcggatg accaggttcc aggggagctg agcgagtcgc ctcccccgcc cagcttcagc 361 cctggctgca gctgcagcgc gagccatgcg cccccagtgc accccggccc ggcccaccgc 421 cccggggcca ttctgctgac cgcccagccc cgagccccga cagtggcaag ftgcggctac 481 tgcagttgca agctccggcc aacccggagg agccccagcg gggagcgcag tgttgcgccc 541 cccgcccccg cgcgccccgc agcagccggg cgttcactca tcctccctcc cccaccgtcc 601 ctcccttttc tcctcaagtc ctgaagttga gtttgagagg cgacacggcg gcggcggccg 661 cgctgctccc gctcctctgc ctccccatgg atatgcactg caaagcagac cccttctccg 721 cgatgcaccc agggcacggg ggtgtgaacc agctcggggg ggtgtttgtg aacggccggc 781 ccctacccga cgtggtgagg cagcgcatcg tggagctggc ccaccagggt gtgcggccct 841 gtgacatctc ccggcagctg cgggtcagcc acggctgtgt cagcaaaatc ctgggcaggt 901 actacgagac cggcagcatc aagccgggtg tgatcggtgg ctccaagccc aaagtggcga 961 cgcccaaagt ggtggacaag attgctgaat acaaacgaca gaacccgact atgttcgcct 1021 gggagattcg agaccggctc ctggccgagg gcatctgtga caatgacaca gtgcccagcg 1081 tctcttccat caacagaatc atccggacca aagttcagca gcctttccac ccaacgccgg 1141 atggggctgg gacaggagtg accgcccctg gccacaccat tgttcccagc acggcctccc 1201 ctcctgtttc cagcgcctcc aatgacccag tgggatccta ctccatcaat gggatcctgg 1261 ggattcctcg ctccaatggt gagaagagga aacgtgatga agttgaggta tacactgatc 1321 ctgcccacat tagaggaggt ggaggtttgc atctggtctg gactttaaga gatgtgtctg 1381 agggctcagt ccccaatgga gattcccaga gtggtgtgga cagtttgcgg aagcacttgc 1441 gagctgacac cttcacccag cagcagctgg aagctttgga tcgggtcttt gagcgtcctt 1501 cctaccctga cgtcttccag gcatcagagc acatcaaatc agaacagggg aacgagtact 1561 ccctcccagc cctgacccct gggcttgatg aagtcaagtc gagtctatct gcatccacca 1621 accctgagct gggcagcaac gtgtcaggca cacagacata cccagttgtg actggtcgtg 1681 acatggcgag caccactctg cctggttacc cccctcacgt gccccccact ggccagggaa 1741 gctaccccac ctccaccctg gcaggaatgg tgcctgggag cgagttctcc ggcaacccgt 1801 acagccaccc ccagtacacg gcctacaacg aggcttggag attcagcaac cccgccttac 1861 taagttcccc ttattattat agtgccgccc cccggtccgc ccctgccgct gctgccgctg 1921 cctatgaccg ccactagtta ccgcggggac cacatcaagc ttcaggccga cagcttcggc 1981 ctccacatcg tccccgtctg accccacccc ggagggaggg aggaccgacg cgacgcgatg 2041 cctcccggcc accgccccag cctcacccca tcccacgacc cccgcaaccc ttcacatcac 2101 ccccctcgaa ggtcggacag gacgggtgga gccgtgggcg ggaccctcag gcccgggccc 2161 gccgccccca gccccgcctg ccgcccctcc ccgcctgcct ggactgcgcg gcgccgtgag 2221 ggggattcgg cccagctcgt cccggcctcc accaagccag ccccgaagcc cgccagccac 2281 cctgccggac tcgggcgcga cctgctggcg cgcgccggat gtttctgtga cacacaatca 2341 gcgcggaccg cagcgcggcc cagccccggg cacccgcctc ggacgctcgg gcgccaggag 2401 gcttcgctgg aggggctggg ccaaggagat taagaagaaa acgactttct gcaggaggaa 2461 gagcccgctg ccgaatccct gggaaaaatt cttttccccc agtgccagcc ggactgccct 2521 cgccttccgg gtgtgccctg tcccagaaga tggaatgggg gtgtgggggt ccggctctag 2581 gaacgggctt tgggggcgtc aggtctttcc aaggttggga cccaaggatc ggggggccca 2641 gcagcccgca ccgatcgagc cggactctcg gctcttcact gctcctcctg gcctgcctag 2701 ttccccaggg cccggcacct cctgctgcga gacccggctc tcagccctgc cttgccccta 2761 cctcagcgtc tcttccacct gctggcctcc cagtttcccc tcctgccagt ccttcgcctg 2821 tcccttgacg ccctgcatcc tcctccctga ctcgcagccc catcggacgc tctcccggga 2881 ccgccgcagg accagtttcc atagactgcg gactggggtc ttcctccagc agttacttga 2941 tgccccctcc cccgacacag actctcaatc tgccggtggt aagaaccggt tctgagctgg 3001 cgtctgagct gctgcggggt ggaagtgggg ggctgcccac tccactcctc ccatcccctc 3061 ccagcctcct cctccggcag gaactgaaca gaaccacaaa aagtctacat ttatttaata 3121 tgatggtctt tgcaaaaagg aacaaaacaa cacaaaagcc caccaggctg ctgctttgtg 3181 gaaagacggt gtgtgtcgtg tgaaggcgaa acccggtgta cataacccct ccccctccgc 3241 cccgccccgc ccggccccgt agagtccctg tcgcccgccg gccctgcctg tagatacgcc 3301 ccgctgtctg tgctgtgaga gtcgccgctc gctggggggg aaggggggga cacagctaca 3361 cgcccattaa agcacagcac gtcctggggg aggggggcat tttttatgtt acaaaaaaaa 3421 attacgaaag aaaagaaatc tctatgcaaa atgacgaaca tggtcctgtg gactcctctg 3481 gcctgttttg ttggctcttt ctctgtaatt ccgtgttttc gctttttcct ccctgcccct 3541 ctctccctct gcccctctct cctctccgct tctctccccc tctgtctctg tctctctccg 3601 tctctgtcgc tcttgtctgt ctgtctctgc tctttcctcg gcctctctcc ccagacctgg 3661 cccggccgcc ctgtctccgc aggctagatc cgaggtggca gctccagccc ccgggctcgc 3721 cccctcgcgg gcgtgccccg cgcgccccgg gcggccgaag gccgggccgc cccgtcccgc 3781 cccgtagttg ctctttcggt agtggcgatg cgccctgcat gtctcctcac ccgtggatcg 3841 tgacgactcg aaataacaga aacaaagtca ataaagtgaa aataaataaa aatccttgaa 3901 caaatccgaa aaggcttgga gtcctcgccc agatctctct cccctgcgag ccctttttat 3961 ttgagaagga aaaagagaaa agagaatcgt ttaagggaac ccggcgccca gccaggctcc 4021 agtggcccga acggggcggc gagggcggcg agggcgccga ggtccggccc atcccagtcc 4081 tgtggggctg gccgggcaga gaccccggac ccaggcccag gcctaacctg ctaaatgtcc 4141 ccggacggtt ctggtctcct cggccacttt cagtgcgtcg gttcgttttg attctttttc 4201 ttttgtgcac ataagaaata aataataata ataaataaag aataaaattt tgtatgtcaa 4261 aaaaaaaaaa aaaaaa Appendix C
LOCUS NM_000278 4207 bp mRNA linear PRI 24-SEP-2005 DEFINITION Homo sapiens paired box gene 2 (PAX2), transcript variant b, mRNA.
ACCESSION NM_000278 VERSION NM_000278.2 GI:34878700 KEYWORDS
SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Catarrhini;
Hominidae; Homo.
REFERENCE 1(bases 1 to 4207) AUTHORS Yoshimura,K., Yoshida,S., Yamaji,Y., Komori,A., Yoshida,A., Hatae,K., Kubota,T. and Ishibashi,T.
TITLE De novo insG619 mutation in PAX2 gene in a Japanese patient with papillorenal syndrome JOURNAL Am. J. Ophthalm:ol. 139 (4), 733-735 (2005) REMARK GeneRIF: Molecular genetic analysis of the PAX2 gene in combination with renal ultrasonography can help in making an earlier diagnosis of the disease.
REFERENCE 2 (bases 1 to 4207) AUTHORS Mazal,P.R., Stichenwirth,M., Koller,A., Blach,S., Haitel,A. and Susani,M.
TITLE Expression of aquaporins and PAX-2 compared to CD10 and cytokeratin 7 in renal neoplasms: a tissue microarray study JOURNAL Mod. Pathol. 18 (4), 535-540 (2005) RElVIARK GeneRIF: PAX-2 is a reliable marker for clear cell renal cell carcinomas of lower grades but not for higher grades.
REFERENCE 3 (bases 1 to 4207) AUTHORS Higashide,T., Wada,T., Sakurai,M., Yokoyama,H. and Sugiyama,K.
TITLE Macular abnormalities and optic disk anomaly associated with a new PAX2 missense mutation JOURNAL Am. J. Ophthalmol. 139 (1), 203-205 (2005) REMARK GeneRIF: A new PAX2 missense mutation, R71T, may cause macular abnormalities in addition to anomalies of the optic disk and the kidney.
REFERENCE 4 (bases 1 to 4207) AUTHORS Buttiglieri,S., Deregibus,M.C., Bravo,S., Cassoni,P., Chiarle,R., Bussolati,B. and Camussi,G.
TITLE Role of Pax2 in apoptosis resistance and proinvasive phenotype of Kaposi's sarcoma cells JOURNAL J. Biol. Chem. 279 (6), 4136-4143 (2004) REIVIARK GeneR.IF: expression of Pax2 by Kaposi's sarcoma cells correlated with an enhanced resistance against apoptotic signals and with the proinvasive phenotype REFERENCE 5 (bases 1 to 4207) AUTHORS Brophy,P.D., Lang,K.M. and Dressler,G.R.
TITLE The secreted frizzled related protein 2 (SFRP2) gene is a target of the Pax2 transcription factor JOURNAL J. Biol. Chem. 278 (52), 52401-52405 (2003) REMARK GeneRIF: Pax2 protein regulates expression of secreted frizzled related protein 2 REFERENCE 6 (bases 1 to 4207) AUTHORS Schimmenti,L.A., Manligas,G.S. and Sieving,P.A.
TITLE Optic nerve dysplasia and renal insufficiency in a family with a novel PAX2 mutation, Arg115X: further ophthalmologic delineation of the renal-coloboma syndrome JOURNAL Ophthalmic Genet. 24 (4), 191-202 (2003) REMARK GeneRIF: PAX2 mutation is associated with Optic nerve dysplasia and renal insufficiency of the renal-coloboma syndrome REFERENCE 7 (bases 1 to 4207) AUTHORS Muratovska,A., Zhou,C., He,S., Goodyer,P. and Eccles,M.R.
TITLE Paired-Box genes are frequently expressed in cancer and often required for cancer cell survival JOURNAL Oncogene 22 (39), 7989-7997 (2003) REMARK GeneRIF: The PAX2 gene was frequently expressed in a panel of 406 common primary tumor tissues and endogenous PAX gene expression is often required for the growth and survival of cancer cells REFERENCE 8 (bases 1 to 4207) AUTHORS Gough,S.M., McDonald,M., Chen,X.N., Korenberg,J.R., Neri,A., Kahn,T., Eccles,M.R. and Morris,C.M.
TITLE Refined physical map of the human PAX21HOX11/NFKB2 cancer gene region at 10q24 and relocalization of the HPV6AI1 viral integration site to 14q13.3-q21.1 JOURNAL BMC Genomics 4(1), (1),9 (2 REFERENCE 9 (bases 1 to 4207) AUTHORS Hoffineister,A., Ropolo,A., Vasseur,S., Mallo,G.V., Bodeker,H., Ritz-Laser,B., Dressler,G.R., Vaccaro,M.I., Dagorn,J.C., Moreno,S.
and Iovanna,J.L.
TITLE The HMG-UY-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter JOURNAL J. Biol. Chem. 277 (25), 22314-22319 (2002) RElVIARK GeneRIF: The HMG-I/Y-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter.
REFERENCE 10 (bases 1 to 4207) AUTHORS Cai,Y., Lechner,M.S., Nihalani,D., Prindle,M.J., Holzman,L.B. and Dressler,G.R.
TITLE Phosphorylation of Pax2 by the c-Jun N-terminal kinase and enhanced Pax2-dependent transcription activation JOURNAL J. Biol. Chem. 277 (2), 1217-1222 (2002) REFERENCE 11 (bases 1 to 4207) AUTHORS Becker,K., Beales,P.L., Calver,D.M., Matthijs,G. and Mohammed,S.N.
TITLE Okihiro syndrome and acro-renal-ocular syndrome: clinical overlap, expansion of the phenotype, and absence of PAX2 mutations in two new families JOURNAL J. Med. Genet. 39 (1), 68-71 (2002) REMARK GeneRIF: The absence of PAX2 mutations has been identified in two families with histories of clinical overlap of Okihiro and acro-renal-ocular syndromes.
REFERENCE 12 (bases 1 to 4207) AUTHORS Eccles,M.R., He,S., Legge,M., Kumar,R., Fox,J., Zhou,C., French,M.
and Tsai,R.W.
TITLE PAX genes in development and disease: the role of PAX2 in urogenital tract development JOURNAL Int. J. Dev. Biol. 46 (4), 535-544 (2002) REMARK Review article GeneRIF: PAX2 has a role in urogenital tract development and disease [review]
REFERENCE 13 (bases 1 to 4207) AUTHORS Chung,G.W., Edwards,A.O., Schimmenti,L.A., Manligas,G.S., Zhang,Y.H. and Ritter,R. III.
TITLE Renal-coloboma syndrome: report of a novel PAX2 gene mutation JOURNAL Am. J. Ophthalmol. 132 (6), 910-914 (2001) REIVIARK GeneRIF: The causal relationship between PAX2 gene mutations and renal-coloboma syndrome is further supported REFERENCE 14 (bases 1 to 4207) AUTHORS Nishimoto,K., Iijima,K., Shirakawa,T., Kitagawa,K., Satomura,K., Nakamura,H. and Yoshikawa,N.
TITLE PAX2 gene mutation in a family with isolated renal hypoplasia JOURNAL J. Am. Soc. Nephrol. 12 (8), 1769-1772 (2001) REFERENCE 15 (bases 1 to 4207) AUTHORS Ritz-Laser,B., Estreicher,A., Gauthier,B. and Philippe,J.
TITLE The paired homeodomain transcription factor Pax-2 is expressed in the endocrine pancreas and transactivates the glucagon gene promoter JOURNAL J. Biol. Chem. 275 (42), 32708-32715 (2000) REFERENCE 16 (bases 1 to 4207) AUTHORS Lechner,M.S., Levitan,I. and Dressler,G.R.
TITLE PTIP, a novel BRCT domain-containing protein interacts with Pax2 and is associated with active chromatin JOURNAL Nucleic Acids Res. 28 (14), 2741-2751 (2000) REFER.ENCE 17 (bases 1 to 4207) AUTHORS Tavassoli,K., Ruger,W. and Horst,J.
TITLE Alternative splicing in PAX2 generates a new reading frame and an extended conserved coding region at the carboxy terminus JOURNAL Hum. Genet. 101 (3), 371-375 (1997) REFERENCE 18 (bases 1 to 4207) AUTHORS Dahl,E., Koseki,H. and Balling,R.
TITLE Pax genes and organogenesis JOURNAL Bioessays 19 (9), 755-765 (1997) RElVIARK Review article REFERENCE 19 (bases 1 to 4207) AUTHORS Schimmenti,L.A., Cunliffe,H.E., McNoe,L.A., Ward,T.A., French,M.C., Shim,H.H., Zhang,Y.H., Proesmans,W., Leys,A., Byerly,K.A., Braddock,S.R., Masuno,M., Imaizumi,K., Devriendt,K. and Eccles,M.R.
TITLE Further delineation of renal-coloboma syndrome in patients with extreme variability of phenotype and identical PAX2 mutations JOURNAL Am. J. Hum. Genet. 60 (4), 869-878 (1997) REFERENCE 20 (bases 1 to 4207) AUTHORS Narahara,K., Baker,E., Ito,S., Yokoyama,Y., Yu,S., Hewitt,D., Sutherland,G.R., Eccles,M.R. and Richards,R.I.
TITLE Localisation of a l Oq breakpoint within the PAX2 gene in a patient with a de novo t(10;13) translocation and optic nerve coloboma-renal disease JOURNAL J. Med. Genet. 34 (3), 213-216 (1997) REFERENCE 21 (bases 1 to 4207) AUTHORS Dehbi,M., Ghahremani,M., Lechner,M., Dressler,G. and Pelletier,J.
TITLE The paired-box transcription factor, PAX2, positively modulates expression of the Wilms' tumor suppressor gene (WT1) JOURNAL Oncogene 13 (3), 447-453 (1996) REFERENCE 22 (bases 1 to 4207) AUTHORS Sanyanusin,P., Norrish,J.H., Ward,T.A., Nebel,A., McNoe,L.A. and Eccles,M.R.
TITLE Genomic structure of the human PAX2 gene JOURNAL Genomics 35 (1), 258-261 (1996) REFERENCE 23 (bases 1 to 4207) AUTHORS Sanyanusin,P., Schimmenti,L.A., McNoe,L.A., Ward,T.A., Pierpont,M.E., Sullivan,M.J., Dobyns,W.B. and Eccles,M.R.
TITLE Mutation of the PAX2 gene in a family with optic nerve colobomas, renal anomalies and vesicoureteral reflux JOURNAL Nat. Genet. 9 (4), 358-364 (1995) REFERENCE 24 (bases 1 to 4207) AUTHORS Ward,T.A., Nebel,A., Reeve,A.E. and Eccles,M.R.
TITLE Alternative messenger RNA forms and open reading frames within an additional conserved region of the human PAX-2 gene JOURNAL Cell Growth Differ. 5(9), 1015-1021 (1994) REFERENCE 25 (bases 1 to 4207) AUTHORS Noll,M.
TITLE Evolution and role of Pax genes JOURNAL Curr. Opin. Genet. Dev. 3 (4), 595-605 (1993) REMARK Review article REFERENCE 26 (bases 1 to 4207) AUTHORS Stapleton,P., Weith,A., Urbanek,P., Kozmik,Z. and Busslinger,M.
TITLE Chromosomal localization of seven PAX genes and cloning of a novel family member, PAX-9 JOURNAL Nat. Genet. 3(4), 292-298 (1993) REFERENCE 27 (bases 1 to 4207) AUTHORS Pilz,A.J., Povey,S., Gruss,P. and Abbott,C.M.
TITLE Mapping of the human homologs of the murine paired-box-containing genes JOURNAL Mamm. Genome 4(2), 78-82 (1993) REFERENCE 28 (bases 1 to 4207) AUTHORS Eccles,M.R., Wallis,L.J., Fidler,A.E., Spurr,N.K., Goodfellow,P.J.
and Reeve,A.E.
TITLE Expression of the PAX2 gene in human fetal kidney and Wilms' tumor JOURNAL Cell Growth Differ. 3 (5), 279-289 (1992) COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from U45255.1 and BM671839.1.
On Sep 22, 2003 this sequence version replaced gi:4557820.
Summary: PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1.
Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.
Transcript Variant: This variant (b) lacks an alternate in-frame exon and uses an alternate splice site in the 3' coding region, compared to variant e. This results in a protein (isoform b) with a shorter, distinct C-terminus compared to isoform e.
CQMPLETENESS: complete on the 3' end.
FEATURES Location/Qualifiers source 1..4207 /organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome=" 10"
/map=" 10q24"
gene 1..4207 /gene="PA.X2"
/db_xref-'-"GeneID:5076"
/db_~cre~"HGNC: 8616"
/db_xref="M]M:167409"
CDS 687..1868 /gene="PAX2"
/note="PAX2 gene is a member of the paired-box containing genes which encode transcription factors involved in embryonic and fetal development; the gene product is nuclear protein which binds DNA
isoform b is encoded by transcript variant b; paired box homeotic gene 2;
go_component: nucleus [goid 0005634] [evidence IEA];
go_function: ATP binding [goid 0005524] [evidence IEA];
go_function: DNA binding [goid 0003677] [evidence IEA];
go_function: DNA binding [goid 0003677] [evidence TAS]
[pmid 9106533];
go_function: nucleoside diphosphate kinase activity [goid 0004550] [evidence IEA];
go_process: development [goid 0007275] [evidence IEA];
go_process: transcription [goid 0006350] [evidence IEA];
go_process: CTP biosynthesis [goid 0006241] [evidence IEA];
go_process: GTP biosynthesis [goid 0006183] [evidence IEA];
go_process: UTP biosynthesis [goid 0006228] [evidence IEA];
go_process: axonogenesis [goid 0007409] [evidence TAS]
[pmid 9106533];
go_process: cell differentiation [goid 0030154] [evidence IEAJa go_process: visual perception [goid 0007601] [evidence TAS] [pmid 9106533];
go_process: regulation of transcription, DNA-dependent [goid 0006355] [evidence IEA];
go_process: transcription from RNA polymerase II promoter [goid 0006366] [evidence TAS] [pmid 8760285]"
/codon start=l /product="paired box protein 2 isoform b"
/protein id="NP_000269.2"
/db_xref--"GI:34878701 "
/dbxref--" GeneID:5076"
/dbxref--"HGNC:8616"
/db xref-'-"MIM:167409"
/translation="MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDV VRQRIVELAH
QGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVDKIAEYK
RQNPTMFAWEIRDRLLAEGICDNDTVPSVS SINRIIRTKVQQPFHPTPDGAGTGVTA
PGHTIVPSTASPPVS SASNDPVGSYSINGILGIPRSNGEKRKRDEDVSEGS VPNGDSQ
SGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTP
GLDEVKS SLSAS TNPELGSNV S GTQTYP V V TGRDMA.STTLPGYPPHVPPTGQGSYP
TSTLAGMVPGSEFS GNPYSHPQYTAYNEAWRFSNPALLS SPYYYSAAPRSAPAAAA
AAYDR
H"
STS 1857..2063 /gene="PAX2"
/standard name="RH80285"
/db_xref'--"UniSTS:88437"
STS 3055..3207 /gene="PAX2"
/standard_name="D 10S2478"
/db_xref="UniSTS :74159"
polyA_signal 4161..4166 /gene="PAX2"
polyA signal 4165..4170 /gene="PAX2" _ polyA_signal 4172..4177 /gene=TAX21' polyA_site 4190 /gene="PAX2"
ORIGIN
1 aggctccagt ctccggccga gtcttctcgc agccgcaacc cacctggggc cagcccagag 61 ctgccagcgc cgctcggctc cctccctccc tcccggccct tcggccgcgg cggcgtgcgc 121 ctgccttttc cgggggcggg ggcctggccc gcgcgctccc ctcccgcagg cgccacctcg 181 gacatccccg ggattgctac ttctctgcca acttcgccaa ctcgccagca cttggagagg 241 cccggctccc ctcccggcgc cctctgaccg cccccgcccc gcgcgctctc cgaccaccgc 301 ctctcggatg accaggttcc aggggagctg agcgagtcgc ctcccccgcc cagcttcagc 361 cctggctgca gctgcagcgc gagccatgcg cccccagtgc accccggccc ggcccaccgc 421 cccggggcca ttctgctgac cgcccagccc cgagccccga cagtggcaag ttgcggctac 481 tgcagttgca agctccggcc aacccggagg agccccagcg gggagcgcag tgttgcgccc 541 cccgcccccg cgcgccccgc agcagccggg cgttcactca tcctccctcc cccaccgtcc 601 ctcccttttc tcctcaagtc ctgaagttga gtttgagagg cgacacggcg gcggcggccg 661 cgctgctccc gctcctctgc ctccccatgg atatgcactg caaagcagac cccttctccg 721 cgatgcaccc agggcacggg ggtgtgaacc agctcggggg ggtgtttgtg aacggccggc 781 ccctacccga cgtggtgagg cagcgcatcg tggagctggc ccaccagggt gtgcggccct 841 gtgacatctc ccggcagctg cgggtcagcc acggctgtgt cagcaaaatc ctgggcaggt 901 actacgagac cggcagcatc aagccgggtg tgatcggtgg ctccaagccc aaagtggcga 961 cgcccaaagt ggtggacaag attgctgaat acaaacgaca gaacccgact atgttcgcct 1021 gggagattcg agaccggctc ctggccgagg gcatctgtga caatgacaca gtgcccagcg 1081 tctcttccat caacagaatc atccggacca aagttcagca gcctttccac ccaacgccgg 1141 atggggctgg gacaggagtg accgcccctg gccacaccat tgttcccagc acggcctccc 1201 ctcctgtttc cagcgcctcc aatgacccag tgggatccta ctccatcaat gggatcctgg 1261 ggattcctcg ctccaatggt gagaagagga aacgtgatga agatgtgtct gagggctcag 1321 tccccaatgg agattcccag agtggtgtgg acagtttgcg gaagcacttg cgagctgaca 1381 ccftcaccca gcagcagctg gaagctttgg atcgggtctt tgagcgtcct tcctaccctg 1441 acgtcttcca ggcatcagag cacatcaaat cagaacaggg gaacgagtac tccctcccag 1501 ccctgacccc tgggcttgat gaagtcaagt cgagtctatc tgcatccacc aaccctgagc 1561 tgggcagcaa cgtgtcaggc acacagacat acccagttgt gactggtcgt gacatggcga 1621 gcaccactct gcctggttac ccccctcacg tgccccccac tggccaggga agctacccca 1681 cctccaccct ggcaggaatg gtgcctggga gcgagttctc cggcaacccg tacagccacc 1741 cccagtacac ggcctacaac gaggcttgga gattcagcaa ccccgcctta ctaagttccc 1801 cttattatta tagtgccgcc ccccggtccg cccctgccgc tgctgccgct gcctatgacc 1861 gccactagtt accgcgggga ccacatcaag cttcaggccg acagcttcgg cctccacatc 1921 gtccccgtct gaccccaccc cggagggagg gaggaccgac gcgacgcgat gcctcccggc 1981 caccgcccca gcctcacccc atcccacgac ccccgcaacc cttcacatca cccccctcga 2041 aggtcggaca ggacgggtgg agccgtgggc gggaccctca ggcccgggcc cgccgccccc 2101 agccccgcct gccgcccctc cccgcctgcc tggactgcgc ggcgccgtga gggggattcg 2161 gcccagctcg tcccggcctc caccaagcca gccccgaagc ccgccagcca ccctgccgga 2221 ctcgggcgcg acctgctggc gcgcgccgga tgtttctgtg acacacaatc agcgcggacc 2281 gcagcgcggc ccagccccgg gcacccgcct cggacgctcg ggcgccagga ggcttcgctg 2341 gaggggctgg gccaaggaga ttaagaagaa aacgactttc tgcaggagga agagcccgct 2401 gccgaatccc tgggaaaaat tcttttcccc cagtgccagc cggactgccc tcgccttccg 2461 ggtgtgccct gtcccagaag atggaatggg ggtgtggggg tccggctcta ggaacgggct 2521 ttgggggcgt caggtctttc caaggttggg acccaaggat cggggggccc agcagcccgc 2581 accgatcgag ccggactctc ggctcttcac tgctcctcct ggcctgccta gttccccagg 2641 gcccggcacc tcctgctgcg agacccggct ctcagccctg ccttgcccct acctcagcgt 2701 ctcttccacc tgctggcctc ccagtttccc ctcctgccag tccttcgcct gtcccttgac 2761 gccctgcatc ctcctccctg actcgcagcc ccatcggacg ctctcccggg accgccgcag 2821 gaccagtttc catagactgc ggactggggt cttcctccag cagttacttg atgccccctc 2881 ccccgacaca gactctcaat ctgccggtgg taagaaccgg ttctgagctg gcgtctgagc 2941 tgctgcgggg tggaagtggg gggctgccca ctccactcct cccatcccct cccagcctcc 3001 tcctccggca ggaactgaac agaaccacaa aaagtctaca tttatttaat atgatggtct 3061 ttgcaaaaag gaacaaaaca acacaaaagc ccaccaggct gctgctttgt ggaaagacgg 3121 tgtgtgtcgt gtgaaggcga aacccggtgt acataacccc tccccctccg ccccgccccg 3181 cccggccccg tagagtccct gtcgcccgcc ggccctgcct gtagatacgc cccgctgtct 3241 gtgctgtgag agtcgccgct cgctgggggg gaaggggggg acacagctac acgcccatta 3301 aagcacagca cgtcctgggg gaggggggca ttttttatgt tacaaaaaaa aattacgaaa 3361 gaaaagaaat ctctatgcaa aatgacgaac atggtcctgt ggactcctct ggcctgtttt 3421 gttggctctt tctctgtaat tccgtgtttt cgctttttcc tccctgcccc tctctccctc 3481 tgcccctctc tcctctccgc ttctctcccc ctctgtctct gtctctctcc gtctctgtcg 3541 ctcttgtctg tctgtctctg ctctttcctc ggcctctctc cccagacctg gcccggccgc 3601 cctgtctccg caggctagat ccgaggtggc agctccagcc cccgggctcg ccccctcgcg 3661 ggcgtgcccc gcgcgccccg ggcggccgaa ggccgggccg ccccgtcccg ccccgtagtt 3721 gctctttcgg tagtggcgat gcgccctgca tgtctcctca cccgtggatc gtgacgactc 3781 gaaataacag aaacaaagtc aataaagtga aaataaataa aaatccttga acaaatccga 3841 aaaggcttgg agtcctcgcc cagatctctc tcccctgcga gcccttttta tttgagaagg 3901 aaaaagagaa aagagaatcg tttaagggaa cccggcgccc agccaggctc cagtggcccg 3961 aacggggcgg cgagggcggc gagggcgccg aggtccggcc catcccagtc ctgtggggct 4021 ggccgggcag agaccccgga cccaggccca ggcctaacct gctaaatgtc cccggacggt 4081 tctggtctcc tcggccactt tcagtgcgtc ggttcgtttt gattcttttt cttttgtgca 4141 cataagaaat aaataataat aataaataaa gaataaaatt ttgtatgtca aaaaaaaaaa 4201 aaaaaaa Appendix D
LOCUS NM_003988 4290 bp mRNA linear PRI 24-SEP-2005 DEFINITION Homo sapiens paired box gene 2 (PAX2), transcript variant c, mRNA.
ACCESSION NM_003988 VERSION NM003988.2 GI:34878708 KEYWORDS .
SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Catarrhini;
Hominidae; Homo.
REFERENCE 1 (bases 1 to 4290) AUTHORS Yoshimura,K., Yoshida,S., Yamaji,Y., Komori,A., Yoshida,A., Hatae,K., Kubota,T. and Ishibashi,T.
TITLE De novo insG6l9 mutation in PAX2 gene in a Japanese patient with papillorenal syndrome JOURNAL Am. J. Ophthalmol. 139 (4), 733-735 (2005) REMARK GeneRIF: Molecular genetic analysis of the PAX2 gene in combination with renal ultrasonography can help in making an earlier diagnosis of the disease.
REFERENCE 2 (bases 1 to 4290) AUTHORS Mazal,P.R., Stichenwirth,M., Koller,A., Blach,S., Haitel,A. and Susani,M.
TITLE Expression of aquaporins and PAX-2 compared to CD 10 and cytokeratin 7 in renal neoplasms: a tissue microarray study JOURNAL Mod. Pathol. 18 (4), 535-540 (2005) ' PUBMED 15502805 REIVIARK GeneRIF: PAX-2 is a reliable marker for clear cell renal cell carcinomas of lower grades but not for higher grades.
REFERENCE 3 (bases 1 to 4290) AUTHORS Higashide,T., Wada,T., Sakurai,M., Yokoyama,H. and Sugiyama,K.
TITLE Macular abnonnalities and optic disk anomaly associated with a new PAX2 missense mutation JOURNAL Am. J. Ophthalmol. 139 (1), 203-205 (2005) REMARK GeneRIF: A new PAX2 missense mutation, R71T, may cause macular abnormalities in addition to anomalies of the optic disk and the kidney.
REFERENCE 4 (bases 1 to 4290) AUTHORS Buttiglieri,S., Deregibus,M.C., Bravo,S., Cassoni,P., Chiarle,R., Bussolati,B. and Camussi,G.
TITLE Role of Pax2 in apoptosis resistance and proinvasive phenotype of Kaposi's sarcoma cells JOURNAL J. Biol. Chem. 279 (6), 4136-4143 (2004) REMARK GeneRIF: expression of Pax2 by Kaposi's sarcoma cells correlated with an enhanced resistance against apoptotic signals and with the proinvasive phenotype REFERENCE 5 (bases 1 to 4290) AUTHORS Brophy,P.D., Lang,K.M. and Dressler,G.R.
TITLE The secreted frizzled related protein 2 (SFRP2) gene is a target of the Pax2 transcription factor JOURNAL J. Biol. Chem. 278 (52), 52401-52405 (2003) REMARK GeneRIF: Pax2 protein regulates expression of secreted frizzled related protein 2 REFERENCE 6 (bases 1 to 4290) AUTHORS Schimmenti,L.A., Manligas,G.S. and Sieving,P.A.
TITLE Optic nerve dysplasia and renal insufficiency in a family with a novel PAX2 mutation, Argl 15X: further ophthalmologic delineation of the renal-coloboma syndrome JOURNAL Ophthalmic Genet. 24 (4), 191-202 (2003) REMARK GeneRIF: PAX2 mutation is associated with Optic nerve dysplasia and renal insufficiency of the renal-coloboma syndrome REFERENCE 7 (bases 1 to 4290) AUTHORS Muratovska,A., Zhou,C., He,S., Goodyer,P. and Eccles,M.R.
TITLE Paired-Box genes are frequently expressed in cancer and often required for cancer cell survival JOURNAL Oncogene 22 (39), 7989-7997 (2003) REMARK GeneRIF: The PAX2 gene was frequently expressed in a panel of 406 common primary tumor tissues and endogenous PAX gene expression is often required for the growth and survival of cancer cells REFERENCE 8 (bases 1 to 4290) AUTHORS Gough,S.M., McDonald,M., Chen,X.N., Korenberg,J.R., Neri,A., Kahn,T., Eccles,M.R. and Morris,C.M.
TITLE Refined physical map of the human PAX2/HOX11/NFKB2 cancer gene region at 10q24 and relocalization of the HPV6AI1 viral integration site to 14q13.3-q21.1 JOURNAL BMC Genomics 4(1), 9 (2003) REFERENCE 9(bases 1 to 4290) AUTHORS Hoffineister,A., Ropolo,A., Vasseur,S., Mallo,G.V., Bodeker,H., Ritz-Laser,B., Dressler,G.R., Vaccaro,M.I., Dagom,J.C., Moreno,S.
and Iovanna,J.L.
TITLE The HMG-I/Y-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter JOURNAL J. Biol. Chem. 277 (25), 22314-22319 (2002) RElVIARK GeneRIF: The HMG-UY-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter.
REFERENCE 10 (bases 1 to 4290) AUTHORS Cai,Y., Lechner,M.S., Nihalani,D., Prindle,M.J., Holzman,L.B. and Dressler,G.R.
TITLE Phosphorylation of Pax2 by the c-Jun N-terminal kinase and enhanced Pax2-dependent transcription activation JOURNAL J. Biol. Chem. 277 (2), 1217-1222 (2002) REFERENCE 11 (bases 1 to 4290) AUTHORS Becker,K., Beales,P.L., Calver,D.M., Matthijs,G. and Mohammed,S.N.
TITLE Okihiro syndrome and acro-renal-ocular syndrome: clinical overlap, expansion of the phenotype, and absence of PAX2 mutations in two new families JOURNAL J. Med. Genet. 39 (1), 68-71 (2002) REMARK GeneRIF: The absence of PAX2 mutations has been identified in two families with histories of clinical overlap of Okihiro and acro-renal-ocular syndromes.
REFERENCE 12 (bases 1 to 4290) AUTHORS Eccles,M.R., He,S., Legge,M., Kumar,R., Fox,.J., Zhou,C., French,M.
and Tsai,R.W.
TITLE PAX genes in development and disease: the role of PAX2 in urogenital tract development JOURNAL Int. J. Dev. Biol. 46 (4), 535-544 (2002) REMARK Review article GeneR1F: PAX2 has a role in urogenital tract development and disease [review]
REFERENCE 13 (bases 1 to 4290) AUTHORS Chung,G.W., Edwards,A.O., Schimmenti,L.A., Manligas,G.S., Zhang,Y.H. and Ritter,R. III.
TITLE Renal-coloboma syndrome: report of a novel PAX2 gene mutation JOURNAL Am. J. Ophthalmol. 132 (6), 910-914 (2001) RElV1ARK GeneRIF: The causal relationship between PAX2 gene mutations and renal-coloboma syndrome is fu.rther supported REFERENCE 14 (bases 1 to 4290) AUTHORS Nishimoto,K., Iijima,K., Shirakawa,T., Kitagawa,K., Satomura,K., Nakamura,H. and Yoshikawa,N.
TITLE PAX2 gene mutation in a family with isolated renal hypoplasia JOURNAL J. Am. Soc. Nephrol. 12 (8), 1769-1772 (2001) REFERENCE 15 (bases 1 to 4290) AUTHORS Ritz-Laser,B., Estreicher,A., Gauthier;B. and Philippe,J.
TITLE The paired homeodomain transcription factor Pax-2 is expressed in the endocrine pancreas and transactivates the glucagon gene promoter JOURNAL J. Biol. Chem. 275 (42), 32708-32715 (2000) REFERENCE 16 (bases 1 to 4290) AUTHORS Lechner,M.S., Levitan,I. and Dressler,G.R.
TITLE PTIP, a novel BRCT domain-containing protein interacts with Pax2 and is associated with active chromatin JOURNAL Nucleic Acids Res. 28 (14), 2741-2751 (2000) REFERENCE 17 (bases 1 to 4290) AUTHORS Tavassoli,K., Ruger,W. and Horst,J.
TITLE Alternative splicing in PAX2 generates a new reading frame and an extended conserved coding region at the carboxy terminus JOURNAL Hum. Genet. 101 (3), 371-375 (1997) REFERENCE 18 (bases 1 to 4290) AUTHORS Dahl,E., Koseki,H. and Balling,R.
TITLE Pax genes and organogenesis JOURNAL Bioessays 19 (9), 755-765 (1997) REIVIARK Review article REFERENCE 19 (bases 1 to 4290) AUTHORS Schimmenti,L.A., Cunliffe,H.E., McNoe,L.A., Ward,T.A., French,M.C., Shim,H.H., Zhang,Y.H., Proesmans,W., Leys,A., Byerly,K.A., Braddock,S.R., Masuno,M., Imaizumi,K., Devriendt,K. and Eccles,M.R.
TITLE Further delineation of renal-coloboma syndrome in patients with extreme variability of phenotype and identical PAX2 mutations JOURNAL Am. J. Hum. Genet. 60 (4), 869-878 (1997) REFERENCE 20 (bases 1 to 4290) AUTHORS Narahara,K., Baker,E., Ito,S., Yokoyama,Y., Yu,S., Hewitt,D., Sutherland,G.R., Eccles,M.R. and Richards,R.I.
TITLE Localisation of a 10q breakpoint within the PAX2 gene in a patient with a de novo t(10;13) translocation and optic nerve coloboma-renal disease JOURNAL J. Med. Genet. 34 (3), 213-216 (1997) REFERENCE 21 (bases 1 to 4290) AUTHORS Dehbi,M., Ghahremani,M., Lechner,M., Dressler,G. and Pelletier,J.
TITLE The paired-box transcription factor, PAX2, positively modulates expression of the Wilms' tumor suppressor gene (WT1) JOURNAL Oncogene 13 (3), 447-453 (1996) REFERENCE 22 (bases 1 to 4290) AUTHORS Sanyanusin,P., Norrish,J.H., Ward,T.A., Nebel,A., McNoe,L.A. and Eccles,M.R.
TITLE Genomic structure of the human PAX2 gene JOURNAL Genomics 35 (1), 258-261 (1996) REFERENCE 23 (bases 1 to 4290) AUTHORS Sanyanusin,P., Schimmenti,L.A., McNoe,L.A., Ward,T.A., Pierpont,M.E., Sullivan,M.J., Dobyns,W.B. and Eccles,M.R.
-- - -TITLE Mutation of the PAX2 gene in a family with optic nerve colobornas, renal anomalies and vesicoureteral reflux JOURNAL Nat. Genet. 9 (4), 358-364 (1995) REFERENCE 24 (bases 1 to 4290) AUTHORS Ward,T.A., Nebel,A., Reeve,A.E. and Eccles,M.R.
TITLE Alternative messenger RNA forms and open reading frames within an additional conserved region of the human PAX-2 gene JOURNAL Cell Growth Differ. 5(9), 1015-1021 (1994) REFERENCE 25 (bases 1 to 4290) AUTHORS Noll,M.
TITLE Evolution and role of Pax genes JOURNAL Curr. Opin. Genet. Dev. 3 (4), 595-605 (1993) REMARK Review article REFERENCE 26 (bases 1 to 4290) AUTHORS Stapleton,P., Weith,A., Urbanek,P., Kozmik,Z. and Busslinger,M.
TITLE Chromosomal localization of seven PAX genes and cloning of a novel family member, PAX-9 JOURNAL Nat. Genet. 3(4), 292-298 (1993) REFERENCE 27 (bases 1 to 4290) AUTHORS Pilz,A.J., Povey,S., Gruss,P. and Abbott,C.M..
TITLE Mapping of the human homologs of the murine paired-box-containing genes JOURNAL Mamm. Genome 4(2), 78-82 (1993) REFERENCE 28 (bases 1 to 4290) AUTHORS Eccles,M.R., Wallis,L.J., Fidler,A.E., Spurr,N.K., Goodfellow,P.J.
and Reeve,A.E.
TITLE Expression of the PAX2 gene in human fetal kidney and Wilms' tumor JOURNAL Cell Growth Differ. 3(5), 279-289 (1992) COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from U45255.1 and BM671839.1.
On Sep 22, 2003 this sequence version replaced gi:4557824.
Summary: PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT 1.
Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.
Transcript Variant: This variant (c) has multiple differences in the coding region, compared to variant e, one of which results in a translational frameshift. The resulting protein (isoform c) has a distinct C-terminus and is shorter than isoform e.
COMPLETENESS: complete on the 3' end.
FEATURES Location/Qualifiers source 1..4290 /organism="Homo sapiens"
/mol type="mRNA"
/dbxref--"taxon:9606"
/chromosome=" 10"
/map="10q24"
gene 1..4290 /gene="PAX2"
/db_xref--" GeneID: 5 076"
/db_xref--"HGNC:8616"
/db_xref'--"MIM:167409"
CDS 687..1877 /gene="PAX2"
/note="PAX2 gene is a member of the paired-box containing genes which encode transcription factors involved in embryonic and fetal development; the gene product is nuclear protein which binds DNA
isoform c is encoded by transcript variant c; paired box homeotic gene 2;
go_component: nucleus [goid 0005634] [evidence lEA];
go_function: ATP binding [goid 0005524] [evidence lEA];
go_function: DNA binding [goid 0003677] [evidence lEA];
go_function: DNA binding [goid 0003677] [evidence TAS]
[pmid 9106533];
go_function: nucleoside diphosphate kinase activity [goid 0004550] [evidence IEA];
go_process: development [goid 0007275] [evidence lEA];
go_process: transcription [goid 0006350] [evidence lEA];
go_process: CTP biosynthesis [goid 0006241] [evidence lEA];
go_process: GTP biosynthesis [goid 0006183] [evidence lEA];
go_process: UTP biosynthesis [goid 0006228] [evidence lEA];
go_process: axonogenesis [goid 0007409] [evidence TAS]
[pmid 9106533];
go_process: cell differentiation [goid 0030154] [evidence lEA];
go_process: visual perception [goid 0007601] [evidence TAS] [pmid 9106533];
go_process: regulation of transcription, DNA-dependent [goid 0006355] [evidence lEA];
go_process: transcription from RNA polymerase II promoter [goid 0006366] [evidence TAS] [pmid 8760285]"
/codon start=1 /product="paired box protein 2 isoform c"
/protein id="NP_003979.2"
/db_xref--" GI:348 78709"
/db_xref--"CCDS :CCDS7499.1"
/dbxref--"GeneID:5 076"
/dbxref--"HGNC:8616"
/db xref--"MIM:167409"
/translation="MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAH
QGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKV VDKIAEYK
RQNPTMFAWEIRDRLLAEGICDNDTVPS VS SINRIIRTKVQQPFHPTPDGAGTGVTA
PGHTIVPSTASPPVS SASNDPVGSYSINGILGII'RSNGEKR KR DEDVSEGSVPNGDSQ
SGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTP
GLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQGSYP
TSTLAGMVPEAAVGPS SSLMSKPGRKLAEVPPCVQPTGAS SPATRTATPSTRPTTRL
GDSA
TPPY"
STS 1940..2146 /gene="PAX2"
/standard_nam.e="RH80285"
/db_xref="Uni S TS : 8 843 7"
STS 3138..3290 /gene="PAX2"
/standardname="D 10S2478"
/db_xref="UniSTS:74159"
polyA_signal 4244..4249 /gene="PAX2"
polyA_signal 4248..4253 /gene="PAX2"
polyA_signal 4255..4260 /gene="PAX2"
polyA_site 4273 /gene="PAX2"
ORIGIN
1 aggctccagt ctccggccga gtcttctcgc agccgcaacc cacctggggc cagcccagag 61 ctgccagcgc cgctcggctc cctccctccc tcccggccct tcggccgcgg cggcgtgcgc 121 ctgccttttc cgggggcggg ggcctggccc gcgcgctccc ctcccgcagg cgccacctcg 181 gacatccccg ggattgctac ttctctgcca acttcgccaa ctcgccagca cttggagagg 241 cccggctccc ctcccggcgc cctctgaccg cccccgcccc gcgcgctctc cgaccaccgc 301 ctctcggatg accaggttcc aggggagctg agcgagtcgc ctcccccgcc cagcttcagc 361 cctggctgca gctgcagcgc gagccatgcg cccccagtgc accccggccc ggcccaccgc 421 cccggggcca ttctgctgac cgcccagccc cgagccccga cagtggcaag ttgcggctac 481 tgcagttgca agctccggcc aacccggagg agccccagcg gggagcgcag tgttgcgccc 541 cccgcccccg cgcgccccgc agcagccggg cgttcactca tcctccctcc cccaccgtcc 601 ctcccttttc tcctcaagtc ctgaagttga gtttgagagg cgacacggcg gcggcggccg 661 cgctgctccc gctcctctgc ctccccatgg atatgcactg caaagcagac cccttctccg 721 cgatgcaccc agggcacggg ggtgtgaacc agctcggggg ggtgtttgtg aacggccggc 781 ccctacccga cgtggtgagg cagcgcatcg tggagctggc ccaccagggt gtgcggccct 641 gtgacatctc ccggcagctg cgggtcagcc acggctgtgt cagcaaaatc ctgggcaggt 901 actacgagac cggcagcatc aagccgggtg tgatcggtgg ctccaagccc aaagtggcga 961 cgcccaaagt ggtggacaag attgctgaat acaaacgaca gaacccgact atgttcgcct 1021 gggagattcg agaccggctc ctggccgagg gcatctgtga caatgacaca gtgcccagcg 1081 tctcttccat caacagaatc atccggacca aagttcagca gcctttccac ccaacgccgg 1141 atggggctgg gacaggagtg accgcccctg gccacaccat tgttcccagc acggcctccc 1201 ctcctgtttc cagcgcctcc aatgacccag tgggatccta ctccatcaat gggatcctgg 1261 ggattcctcg ctccaatggt gagaagagga aacgtgatga agatgtgtct gagggctcag 1321 tccccaatgg agattcccag agtggtgtgg acagtttgcg gaagcacttg cgagctgaca 1381 ccttcaccca gcagcagctg gaagctttgg atcgggtctt tgagcgtcct tcctaccctg 1441 acgtcttcca ggcatcagag cacatcaaat cagaacaggg gaacgagtac tccctcccag 1501 ccctgacccc tgggcttgat gaagtcaagt cgagtctatc tgcatccacc aaccctgagc 1561 tgggcagcaa cgtgtcaggc acacagacat acccagttgt gactggtcgt gacatggcga 1621 gcaccactct gcctggttac ccccctcacg tgccccccac tggccaggga agctacccca 1681 cctccaccct ggcaggaatg gtgcctgagg ctgcagttgg tccctcatcc tccctcatga 1741 gcaagccggg gaggaagctt gcagaagtgc ccccttgtgt gcaacccact ggagcgagtt 1801 ctccggcaac ccgtacagcc acccccagta cacggcctac aacgaggctt ggagattcag 1861 caaccccgcc ttactaagtt ccccttatta ttatagtgcc gccccccggt ccgcccctgc 1921 cgctgctgcc gctgcctatg accgccacta gttaccgcgg ggaccacatc aagcttcagg 1981 ccgacagctt cggcctccac atcgtccccg tctgacccca ccccggaggg agggaggacc 2041 gacgcgacgc gatgcctccc ggccaccgcc ccagcctcac cccatcccac gacccccgca 2101 acccttcaca tcacccccct cgaaggtcgg acaggacggg tggagccgtg ggcgggaccc 2161 tcaggcccgg gcccgccgcc cccagccccg cctgccgccc ctccccgcct gcctggactg 2221 cgcggcgccg tgagggggat tcggcccagc tcgtcccggc ctccaccaag ccagccccga 2281 agcccgccag ccaccctgcc ggactcgggc gcgacctgct ggcgcgcgcc ggatgtttct 2341 gtgacacaca atcagcgcgg accgcagcgc ggcccagccc cgggcacccg cctcggacgc 2401 tcgggcgcca ggaggcttcg ctggaggggc tgggccaagg agattaagaa gaaaacgact 2461 ttctgcagga ggaagagccc gctgccgaat ccctgggaaa aattcttttc ccccagtgcc 2521 agccggactg ccctcgcctt ccgggtgtgc cctgtcccag aagatggaat gggggtgtgg 2581 gggtccggct ctaggaacgg gctttggggg cgtcaggtct ttccaaggtt gggacccaag 2641 gatcgggggg cccagcagcc cgcaccgatc gagccggact ctcggctctt cactgctcct 2701 cctggcctgc ctagttcccc agggcccggc acctcctgct gcgagacccg gctctcagcc 2761 ctgccttgcc cctacctcag cgtctcttcc acctgctggc ctcccagttt cccctcctgc 2821 cagtccttcg cctgtccctt gacgccctgc atcctcctcc ctgactcgca gccccatcgg 2881 acgctctccc gggaccgccg caggaccagt ttccatagac tgcggactgg ggtcttcctc 2941 cagcagttac ttgatgcccc ctcccccgac acagactctc aatctgccgg tggtaagaac 3001 cggttctgag ctggcgtctg agctgctgcg gggtggaagt ggggggctgc ccactccact 3061 cctcccatcc cctcccagcc tcctcctccg gcaggaactg aacagaacca caaaaagtct 3121 acatttattt aatatgatgg tctttgcaaa aaggaacaaa acaacacaaa agcccaccag 3181 gctgctgctt tgtggaaaga cggtgtgtgt cgtgtgaagg cgaaacccgg tgtacataac 3241 ccctccccct ccgccccgcc ccgcccggcc ccgtagagtc cctgtcgccc gccggccctg 3301 cctgtagata cgccccgctg tctgtgctgt gagagtcgcc gctcgctggg ggggaagggg 3361 gggacacagc tacacgccca ttaaagcaca gcacgtcctg ggggaggggg gcatttttta 3421 tgttacaaaa aaaaattacg aaagaaaaga aatctctatg caaaatgacg aacatggtcc 3481 tgtggactcc tctggcctgt tttgttggct ctttctctgt aattccgtgt tttcgctttt 3541 tcctccctgc ccctctctcc ctctgcccct ctctcctctc cgcttctctc cccctctgtc 3601 tctgtctctc tccgtctctg tcgctcttgt ctgtctgtct ctgctctttc ctcggcctct 3661 ctccccagac ctggcccggc cgccctgtct ccgcaggcta gatccgaggt ggcagctcca 3721 gcccccgggc tcgccccctc gcgggcgtgc cccgcgcgcc ccgggcggcc gaaggccggg 3781 ccgccccgtc ccgccccgta gttgctcttt cggtagtggc gatgcgccct gcatgtctcc 3841 tcacccgtgg atcgtgacga ctcgaaataa cagaaacaaa gtcaataaag tgaaaataaa 3901 taaaaatcct tgaacaaatc cgaaaaggct tggagtcctc gcccagatct ctctcccctg 3961 cgagcccttt ttatttgaga aggaaaaaga gaaaagagaa tcgtttaagg gaacccggcg 4021 cccagccagg ctccagtggc ccgaacgggg cggcgagggc ggcgagggcg ccgaggtccg 4081 gcccatccca gtcctgtggg gctggccggg cagagacccc ggacccaggc ccaggcctaa 4141 cctgctaaat gtccccggac ggttctggtc tcctcggcca ctttcagtgc gtcggttcgt 4201 tttgattctt tttcttttgt gcacataaga aataaataat aataataaat aaagaataaa 4261 attttgtatg tcaaaaaaaa aaaaaaaaaa Appendix E
LOCUS NM_003989 4188 bp inRNA linear PRI 24-SEP-2005 DEFINITION Homo sapiens paired box gene 2 (PAX2), transcript variant d, mRNA.
ACCESSION NM_003989 VERSION NM003989.2 GI:34878715 KEYWORDS .
SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Catarrhini;
Hominidae; Homo.
REFERENCE 1 (bases 1 to 4188) AUTHORS Yoshimura,K., Yoshida,S., Yamaji,Y., Komori,A., Yoshida,A., Hatae,K., Kubota,T. and Ishibashi,T.
TITLE De novo insG6l9 mutation in PAX2 gene in a Japanese patient with papillorenal syndrome JOURNAL Am. J. Ophthalmol. 139 (4), 733-735 (2005) RElV1ARK GeneRIF: Molecular genetic analysis of the PAX2 gene in combination with renal ultrasonography can help in making an earlier diagnosis of the disease.
REFERENCE 2 (bases i to 4188) AUTHORS Mazal,P.R., Stichenwirth,M., Koller,A., Blach,S., Haitel,A. and Susani,M.
TITLE Expression of aquaporins and PAX-2 compared to CD10 and cytokeratin 7 in renal neoplasms: a tissue microarray study JOURNAL Mod. Pathol. 18 (4), 535-540 (2005) REMARK GeneRIF: PAX-2 is a reliable marker for clear cell renal cell carcinomas of lower grades but not for higher grades.
REFERENCE 3 (bases 1 to 4188) AUTHORS Higashide,T., Wada,T., Sakurai,M., Yokoyama,H. and Sugiyama,K.
TITLE Macular abnormalities and optic disk anomaly associated with a new PAX2 missense mutation JOURNAL Am. J. Ophthalmol. 139 (1), 203-205 (2005) REMARK GeneRIF: A new PAX2 missense mutation, R71T, may cause macular abnormalities in addition to anomalies of the optic disk and the kidney.
REFERENCE 4 (bases 1 to 4188) AUTHORS Buttiglieri,S., Deregibus,M.C., Bravo,S., Cassoni,P., Chiarle,R., Bussolati,B. and Camussi,G.
TITLE Role of Pax2 in apoptosis resistance and proinvasive phenotype of Kaposi's sarcoma cells JOURNAL J. Biol. Chem. 279 (6), 4136-4143 (2004) REMARK GeneRIF: expression of Pax2 by Kaposi's sarcoma cells correlated with an enhanced resistance against apoptotic signals and with the proinvasive phenotype REFERENCE 5 (bases 1 to 4188) AUTHORS Brophy,P.D., Lang,K.M. and Dressler,G.R.
TITLE The secreted frizzled related protein 2 (SFRP2) gene is a target of the Pax2 transcription factor JOURNAL J. Biol. Chem. 278 (52), 52401-52405 (2003) REMARK GeneRIF: Pax2 protein regulates expression of secreted frizzled related protein 2 REFERENCE 6 (bases 1 to 4188) AUTHORS Schimmenti,L.A., Manligas,G.S. and Sieving,P.A.
TITLE Optic nerve dysplasia and renal insufficiency in a family with a novel PAX2 mutation, Argl 15X: further ophthalmologic delineation of the renal-coloboma syndrome JOURNAL Ophthalmic Genet. 24 (4), 191-202 (2003) REMARK GeneRIF: PAX2 mutation is associated with Optic nerve dysplasia and renal insufficiency of the renal-coloboma syndrome REFERENCE 7 (bases 1 to 4188) AUTHORS Muratovska,A., Zhou,C., He,S., Goodyer,P. and Eccles,M.R.
TITLE Paired-Box genes are frequently expressed in cancer and often required for cancer cell survival JOURNAL Oncogene 22 (39), 7989-7997 (2003) REMARK GeneRIF: The PAX2 gene was frequently expressed in a panel of 406 common primary tumor tissues and endogenous PAX gene expression is often required for the growth and survival of cancer cells REFERENCE 8 (bases 1 to 4188) AUTHORS Gough,S.M., McDonald,M., Chen,X.N., Korenberg,J.R., Neri,A., Kahn,T., Eccles,M.R. and Morris,C.M.
TITLE Refined physical map of the human PAX2/HOX11/NFKB2 cancer gene region at 10q24 and relocalization of the HPV6AI1 viral integration site to 14q13.3-q21.1 JOURNAL BMC Genomics 4(1), (1),9 (2 REFERENCE 9 (bases 1 to 4188) AUTHORS Hoffineister,A., Ropolo,A., Vasseur,S., Mallo,G.V., Bodeker,H., Ritz-Laser,B., Dressler,G.R., Vaccaro,M.I., Dagorn,J.C., Moreno,S.
and Iovanna,J.L.
TITLE The HMG-I/Y-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter JOURNAL J. Biol. Chem. 277 (25), 22314-22319 (2002) REMARK GeneRIF: The HMG-I/Y-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter.
REFERENCE 10 (bases 1 to 4188) AUTHORS Cai,Y., Lechner,M.S., Nihalani,D., Prindle,M.J., Holzman,L.B. and Dressler,G.R.
TITLE Phosphorylation of Pax2 by the c-Jun N-terminal kinase and enhanced Pax2-dependent transcription activation JOURNAL J. Biol. Chem. 277 (2), 1217-1222 (2002) REFERENCE 11 (bases 1 to 4188) AUTHORS Becker,K., Beales,P.L., Calver,D.M., Matthijs,G. and Mohammed,S.N.
TITLE Okihiro syndrome and acro-renal-ocular syndrome: clinical overlap, expansion of the phenotype, and absence of PAX2 mutations in two new families JOURNAL J. Med. Genet. 39 (1), 68-71 (2002) REMARK GeneRIF: The absence of PAX2 mutations has been identified in two families with histories of clinical overlap of Okihiro and acro-renal-ocular syndromes.
REFERENCE 12 (bases 1 to 4188) AUTHORS. Eccles,M.R., He,S., Legge,M., Kumar,R., Fox,J., Zhou,C., French,M.
and Tsai,R.W.
TITLE PAX genes in development and disease: the role of PAX2 in urogenital tract development JOURNAL Int. J. Dev. Biol. 46 (4), 535-544 (2002) REMARK Review article GeneRIF: PAX2 has a role in urogenital tract development and disease [review]
REFERENCE 13 (bases 1 to 4188) AUTHORS Chung,G.W., Edwards,A.O., Schimmenti,L.A., Manligas,G.S., Zhang,Y.H. and Ritter,R. III.
TITLE Renal-c,oloboma syndrome: report of a novel PAX2 gene mutation JOURNAL Am. J. Ophthalmol. 132 (6), 910-914 (2001) RElVIARK GeneRIF: The causal relationship between PAX2 gene mutations and renal-coloboma syndrome is fiirther supported REFERENCE 14 (bases 1 to 4188) AUTHORS Nishimoto,K., Iijima,K., Shirakawa,T., Kitagawa,K., Satomura,K., Nakamura,H. and Yoshikawa,N.
TITLE PAX2 gene mutation in a family with isolated renal hypoplasia JOURNAL J. Am. Soc. Nephrol. 12 (8), 1769-1772 (2001) REFERENCE 15 (bases 1 to 4188) AUTHORS Ritz-Laser,B., Estreicher,A., Gauthier;B. and Philippe,J.
TITLE The paired homeodomain transcription factor Pax-2 is expressed in the endocrine pancreas and transactivates the glucagon gene promoter JOURNAL J. Biol. Chem. 275 (42), 32708-32715 (2000) REFERENCE 16 (bases 1 to 4188) AUTHORS Lechner,M.S., Levitan,I. and Dressler,G.R.
TITLE PTIP, a novel BRCT domain-containing protein interacts with Pax2 and is associated with active chromatin JOURNAL Nucleic Acids Res. 28 (14), 2741-2751 (2000) REFERENCE 17 (bases 1 to 4188) AUTHORS Tavassoli,K., Ruger,W. and Horst,J.
TITLE Alternative splicing in PAX2 generates a new reading frame and an extended conserved coding region at the carboxy terminus JOURNAL Hum. Genet. 101 (3), 371-375 (1997) REFERENCE 18 (bases 1 to 4188) AUTHORS Dahl,E., Koseki,H. and Balling,R.
TITLE Pax genes and organogenesis JOURNAL Bioessays 19 (9), 755-765 (1997) REMARK Review article REFERENCE 19 (bases 1 to 4188) AUTHORS Schimmenti,L.A., Cunliffe,H.E., McNoe,L.A., Ward,T.A., French,M.C., Shim,H.H., Zhang,Y.H., Proesmans,W., Leys,A., Byerly,K.A., Braddock,S.R., Masuno,M., Imaizumi,K., Devriendt,K. and Eccles,M.R.
TITLE Further delineation of renal-coloboma syndrome in patients with extreme variability of phenotype and identical PAX2 mutations JOURNAL Am. J. Hum. Genet. 60 (4), 869-878 (1997) REFERENCE 20 (bases 1 to 4188) AUTHORS Narahara,K., Baker,E., Ito,S., Yokoyama,Y., Yu,S., Hewitt,D., Sutherland,G.R., Eccles,M.R. and Richards,R.I.
TITLE Localisation of a l Oq breakpoint within the PAX2 gene in a patient with a de novo t(10;13) translocation and optic nerve coloboma-renal disease JOURNAL J. Med. Genet. 34 (3), 213-216 (1997) REFERENCE 21 (bases 1 to 4188) AUTHORS Dehbi,M., Ghahremani,M., Lechner,M., Dressler,G. and Pelletier,J.
TITLE The paired-box transcription factor, PAX2, positively modulates expression of the Wilms' tumor suppressor gene (WT1) JOURNAL Oncogene 13 (3), 447-453 (1996) REFERENCE 22 (bases 1 to 4188) AUTHORS Sanyanusin,P., Norrish,J.H., Ward,T.A., Nebel,A., McNoe,L.A. and Eccles,M.R.
TITLE Genomic structure of the human PAX2 gene JOURNAL Genomics 35 (1), 258-261 (1996) REFERENCE 23 (bases 1 to 4188) AUTHORS Sanyanusin,P., Schimmenti,L.A., McNoe,L.A., Ward,T.A., Pierpont,M.E., Sullivan,M.J., Dobyns,W.B. and Eccles,M.R.
TITLE Mutation of the PAX2 gene in a family with optic nerve colobomas, renal anomalies and vesicoureteral reflux JOURNAL Nat. Genet. 9(4), 358-364 (1995) REFERENCE 24 (bases 1 to 4188) AUTHORS Ward,T.A., Nebel,A., Reeve,A.E. and Eccles,M.R.
TITLE Alternative messenger RNA forms and open reading frames within an additional conserved region of the human PAX-2 gene JOURNAL Cell Growth Differ. 5(9), 1015-1021 (1994) REFERENCE 25 (bases 1 to 4188) AUTHORS Noll,M.
TITLE Evolution and role of Pax genes JOURNAL Curr. Opin. Genet. Dev. 3 (4), 595-605 (1993) REMARK Review article REFERENCE 26 (bases 1 to 4188) AUTHORS Stapleton,P., Weith,A., Urbanek,P., Kozmik,Z. and Busslinger,M.
TITLE Chromosomal localization of seven PAX genes and cloning of a novel family member, PAX-9 JOURNAL Nat. Genet. 3(4), 292-298 (1993) REFERENCE 27 (bases 1 to 4188) AUTHORS Pilz,A.J., Povey,S., Gruss,P. and Abbott,C.M.
TITLE Mapping of the human homologs of the murine paired-box-containing genes JOURNAL Mamm. Genome 4(2), 78-82 (1993) REFERENCE 28 (bases 1 to 4188) AUTHORS Eccles,M.R., Wallis,L.J., Fidler,A.E., Spurr,N.K., Goodfellow,P.J.
and Reeve,A.E.
TITLE Expression of the PAX2 gene in human fetal kidney and Wilms' tumor JOURNAL Cell Growth Differ. 3(5), 279-289 (1992) COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from U45255.1 and BM671839.1.
On Sep 22, 2003 this sequence version replaced gi:4557826.
Summary: PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1.
Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.
Transcript Variant: This variant (d) lacks an alternate in-frame exon compared to variant e. This results in an isoform (isoform d) that is shorter than isoform e.
COMPLETENESS: complete on the 3' end.
FEATURES Location/Qualifiers source 1..4188 /organism="Homo sapiens"
/mol_type="mRNA"
/db_xref-"taxon: 9606"
/chromosome=" 10"
/map=" 10q24"
gene 1..4188 /gene="PAX2"
/db_xref "GeneID:5076"
/dbxref-'HGNC:8616"
/db_xref--"HPRD:HPRD_01330"
/db_xref-"MIM:167409"
CDS 687..1913 /gene="PAX2"
/note="PAX2 gene is a member of the paired-box containing genes which encode transcription factors involved in embryonic and fetal development; the gene product is nuclear protein which binds DNA
isoform d is encoded by transcript variant d; paired box homeotic gene 2;
go_component: nucleus [goid 0005634] [evidence IEA];
go_function: ATP binding [goid 0005524] [evidence IEA];
go_function: DNA binding [goid 0003677] [evidence IEA];
go_function: DNA binding [goid 0003677] [evidence TAS]
[pmid 9106533];
go_fiinction: nucleoside diphosphate kinase activity [goid 0004550] [evidence IEA];
go_process: development [goid 0007275] [evidence IEA];
go_process: transcription [goid 0006350] [evidence IEA];
go_process: CTP biosynthesis [goid 0006241] [evidence IEA];
go_process: GTP biosynthesis [goid 0006183] [evidence IEA];
go_process: UTP biosynthesis [goid 0006228] [evidence IEA];
go_process: axonogenesis [goid 0007409] [evidence TAS]
[pmid 9106533];
go_process: cell differentiation [goid 0030154] [evidence IEA];
go_process: visual perception [goid 0007601] [evidence TAS] [pmid 9106533];
go_process: regulation of transcription, DNA-dependent [goid 0006355] [evidence IEA];
go-process: transcription from RNA polymerase II promoter [goid 0006366] [evidence TAS] [pmid 8760285]"
/codon start=1 /product="paired box protein 2 isoform d"
/protein id="NP_003980.2"
/dbxref--"GI:34878716"
/dbxref--" GeneID: 5 076"
/db_xref--"HGNC:8616"
/db_xre f--"HPRD : HPRD_013 3 0"
/db xref--"MIM:167409"
/translation="MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPD V VRQRIVELAH
QGVRPCDISRQLRV SHGCV SKILGRYYETGS IKP GV IGGSKPKVATPKV VDKIAEYK
RQNPTMFAWEIRDRLLAEGICDNDTVPS VSSINRIIRTKVQQPFHPTPDGAGTGVTA
PGHTIVPSTASPPV S SASNDPV GSYSINGILGIPRSNGEKR KR DEDV SEGS VPNGD S Q
SGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTP
GLDEVKS SLSASTNPELGSNV S GTQTYPV VTGRDMASTTLPGYPPHVPPTGQGSYP
TSTLAGMVPGSEFS GNPYSHPQYTAYNEAWRFSNPALLMPPPGPPLPLLPLPMTATS
YRGDHIKLQAD SFGLHIVP V"
STS 1838..2044 /gene="PAX2"
/standard_name="RH80285"
/db_xref--"Uni S T S: 8 843 7"
STS 3036..3188 /gene="PAX2"
/standard name="Dl0S2478"
/db_xref="Uni S T S: 7415 9"
polyA_signal 4142..4147 /gene="PAX2"
polyA_signal 4146..4151 /gene="PAX2"
p o lyA_s i gnal 415 3..415 8 /gene="PAX2"
polyAAsite 4171 /gene="PAX2"
ORIGIN
1 aggctccagt ctccggccga gtcttctcgc agccgcaacc cacctggggc cagcccagag 61 ctgccagcgc cgctcggctc cctccctccc tcccggccct tcggccgcgg cggcgtgcgc 121 ctgccttttc cgggggcggg ggcctggccc gcgcgctccc ctcccgcagg cgccacctcg 181 gacatccccg ggattgctac ttctctgcca acttcgccaa ctcgccagca cttggagagg 241 cccggctccc ctcccggcgc cctctgaccg cccccgcccc gcgcgctctc cgaccaccgc 301 ctctcggatg accaggttcc aggggagctg agcgagtcgc ctcccccgcc cagcttcagc 361 cctggctgca gctgcagcgc gagccatgcg cccccagtgc accccggccc ggcccaccgc 421 cccggggcca ttctgctgac cgcccagccc cgagccccga cagtggcaag ttgcggctac 481 tgcagttgca agctccggcc aacccggagg agccccagcg gggagcgcag tgttgcgccc 541 cccgcccccg cgcgccccgc agcagccggg cgttcactca tcctccctcc cccaccgtcc 601 ctcccttttc tcctcaagtc ctgaagttga gtttgagagg cgacacggcg gcggcggccg 661 cgctgctccc gctcctctgc ctccccatgg atatgcactg caaagcagac cccttctccg 721 cgatgcaccc agggcacggg ggtgtgaacc agctcggggg ggtgtttgtg aacggccggc 781 ccctacccga cgtggtgagg cagcgcatcg tggagctggc ccaccagggt gtgcggccct 841 gtgacatctc ccggcagctg cgggtcagcc acggctgtgt cagcaaaatc ctgggcaggt 901 actacgagac cggcagcatc aagccgggtg tgatcggtgg ctccaagccc aaagtggcga 961 cgcccaaagt ggtggacaag attgctgaat acaaacgaca gaacccgact atgttcgcct 1021 gggagattcg agaccggctc ctggccgagg gcatctgtga caatgacaca gtgcccagcg 1081 tctcttccat caacagaatc atccggacca aagttcagca gcctttccac ccaacgccgg 1141 atggggctgg gacaggagtg accgcccctg gccacaccat tgttcccagc acggcctccc 1201 ctcctgtttc cagcgcctcc aatgacccag tgggatccta ctccatcaat gggatcctgg 1261 ggattcctcg ctccaatggt gagaagagga aacgtgatga agatgtgtct gagggctcag 1321 tccccaatgg agattcccag agtggtgtgg acagtttgcg gaagcacttg cgagctgaca 1381 ccttcaccca gcagcagctg gaagctttgg atcgggtctt tgagcgtcct tcctaccctg 1441 acgtcttcca ggcatcagag cacatcaaat cagaacaggg gaacgagtac tccctcccag 1501 ccctgacccc tgggcttgat gaagtcaagt cgagtctatc tgcatccacc aaccctgagc 1561 tgggcagcaa cgtgtcaggc acacagacat acccagttgt gactggtcgt gacatggcga 1621 gcaccactct gcctggttac ccccctcacg tgccccccac tggccaggga agctacccca 1681 cctccaccct ggcaggaatg gtgcctggga gcgagttctc cggcaacccg tacagccacc 1741 cccagtacac ggcctacaac gaggcttgga gattcagcaa ccccgcctta ctaatgccgc 1801 cccccggtcc gcccctgccg ctgctgccgc tgcctatgac cgccactagt taccgcgggg 1861 accacatcaa gcttcaggcc gacagcttcg gcctccacat cgtccccgtc tgaccccacc 1921 ccggagggag ggaggaccga cgcgacgcga tgcctcccgg ccaccgcccc agcctcaccc 1981 catcccacga cccccgcaac ccttcacatc acccccctcg aaggtcggac aggacgggtg 2041 gagccgtggg cgggaccctc aggcccgggc ccgccgcccc cagccccgcc tgccgcccct 2101 ccccgcctgc ctggactgcg cggcgccgtg agggggattc ggcccagctc gtcccggcct 2161 ccaccaagcc agccccgaag cccgccagcc accctgccgg actcgggcgc gacctgctgg 2221 cgcgcgccgg atgtttctgt gacacacaat cagcgcggac cgcagcgcgg cccagccccg 2281 ggcacccgcc tcggacgctc gggcgccagg aggcttcgct ggaggggctg ggccaaggag 2341 attaagaaga aaacgacttt ctgcaggagg aagagcccgc tgccgaatcc ctgggaaaaa 2401 ttcttttccc ccagtgccag ccggactgcc ctcgccttcc gggtgtgccc tgtcccagaa 2461 gatggaatgg gggtgtgggg gtccggctct aggaacgggc tttgggggcg tcaggtcttt 2521 ccaaggttgg gacccaagga tcggggggcc cagcagcccg caccgatcga gccggactct 2581 cggctcttca ctgctcctcc tggcctgcct agttccccag ggcccggcac ctcctgctgc 2641 gagacccggc tctcagccct gccttgcccc tacctcagcg tctcttccac ctgctggcct 2701 ccoagtttcc cctcctgcca gtccttcgcc tgtcccttga cgccctgcat cctcctccct 2761 gactcgcagc cccatcggac gctctcccgg gaccgccgca ggaccagttt ccatagactg 2821 cggactgggg tcttcctcca gcagttactt gatgccccct cccccgacac agactctcaa 2881 tctgccggtg gtaagaaccg gttctgagct ggcgtctgag ctgctgcggg gtggaagtgg 2941 ggggctgccc actccactcc tcccatcccc tcccagcctc ctcctccggc aggaactgaa 3001 cagaaccaca aaaagtctac atttatttaa tatgatggtc tttgcaaaaa ggaacaaaac 3061 aacacaaaag cccaccaggc tgctgctttg tggaaagacg gtgtgtgtcg tgtgaaggcg 3121 aaacccggtg tacataaccc ctccccctcc gccccgcccc gcccggcccc gtagagtccc 3181 tgtcgcccgc cggccctgcc tgtagatacg ccccgctgtc tgtgctgtga gagtcgccgc 3241 tcgctggggg ggaagggggg gacacagcta cacgcccatt aaagcacagc acgtcctggg 3301 ggaggggggc attttttatg ttacaaaaaa aaattacgaa agaaaagaaa tctctatgca 3361 aaatgacgaa catggtcctg tggactcctc tggcctgttt tgttggctct ttctctgtaa 3421 ttccgtgttt tcgctttttc ctccctgccc ctctctccct ctgcccctct ctcctctccg 3481 cttctctccc cctctgtctc tgtctctctc cgtctctgtc gctcttgtct gtctgtctct 3541 gctctttcct cggcctctct ccccagacct ggcccggccg ccctgtctcc gcaggctaga 3601 tccgaggtgg cagctccagc ccccgggctc gccccctcgc gggcgtgccc cgcgcgcccc 3661 gggcggccga aggccgggcc gccccgtccc gccccgtagt tgctctttcg gtagtggcga 3721 tgcgccctgc atgtctcctc acccgtggat cgtgacgact cgaaataaca gaaacaaagt 3781 caataaagtg aaaataaata aaaatccttg aacaaatccg aaaaggcttg gagtcctcgc 3841 ccagatctct ctcccctgcg agcccttttt atttgagaag gaaaaagaga aaagagaatc 3901 gtttaaggga acccggcgcc cagccaggct ccagtggccc gaacggggcg gcgagggcgg 3961 cgagggcgcc gaggtccggc ccatcccagt cctgtggggc tggccgggca gagaccccgg 4021 acccaggccc aggcctaacc tgctaaatgt ccccggacgg ttctggtctc ctcggccact 4081 ttcagtgcgt cggttcgttt tgattctttt tcttttgtgc acataagaaa taaataataa 4141 taataaataa agaataaaat tttgtatgtc aaaaaaaaaa aaaaaaaa APPENDIX F
LOCUS NM_003990 4257 bp mRNA linear PRI 24-SEP-2005 DEFINITION Homo sapiens paired box gene 2 (PAX2), transcript variant e, mRNA.
VERSION NM_003990.2 GI:34878702 KEYWORDS
SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; 'Vertebrata; Euteleostomi;
Manimalia; Eutheria; Euarchontoglires; Primates; Catarrhini;
Hominidae; Homo.
REFERENCE 1 (bases 1 to 4257) AUTHORS Yoshimura,K., Yoshida,S., Yamaji,Y., Komori,A., Yoshida,A., Hatae,K., Kubota,T. and Ishibashi,T.
TITLE De novo insG619 mutation in PAX2 gene in a Japanese patient with papillorenal syndrome JOURNAL Am. J. Ophthalmol. 139 (4), 733-735 (2005) REMARK GeneRIF: Molecular genetic analysis of the PAX2 gene in combination with renal ultrasonography can help in making an earlier diagnosis of the disease.
REFERENCE 2 (bases 1 to 4257) AUTHORS Mazal,P.R., Stichenwirth,M., Ko11er,A., Blach,S., Haitel,A. and Susani,M.
TITLE Expression of aquaporins and PAX-2 compared to CD10 and cytokeratin 7 in renal neoplasms: a tissue microarray study JOURNAL Mod. Pathol. 18 (4), 535-540 (2005) REMARK GeneRIF: PAX-2 is a reliable marker for clear cell renal cell carcinomas of lower grades but not for higher grades.
REFERENCE 3 (bases 1 to 4257) AUTHORS Higashide,T., Wada,T., Sakurai,M., Yokoyama,H. and Sugiyama,K.
TITLE Macular abnormalities and optic disk anomaly associated with a new PAX2 missense mutation JOURNAL Am. J. Ophthalmol. 139 (1), 203-205 (2005) REMARK GeneRIF: A new PAX2 missense mutation, R71T, may cause macular abnormalities in addition to anomalies of the optic disk and the kidney.
REFERENCE 4 (bases 1 to 4257) AUTHORS Buttiglieri,S., Deregibus,M.C., Bravo,S., Cassoni,P., Chiarle,R., Bussolati,B. and Camussi,G.
TITLE Role of Pax2 in apoptosis resistance and proinvasive phenotype of Kaposi's sarcoma cells JOURNAL J. Biol. Chem. 279 (6), 4136-4143 (2004) REMARK GeneRIF: expression of Pax2 by Kaposi's sarcoma cells correlated with an enhanced resistance against apoptotic signals and with the proinvasive phenotype REFERENCE 5 (bases 1 to 4257) AUTHORS Brophy,P.D., Lang,K.M. and Dressler,G.R.
TITLE The secreted frizzled related protein 2 (SFRP2) gene is a target of the Pax2 transcription factor JOURNAL J. Biol. Chem. 278 (52), 52401-52405 (2003) REMARK GeneRIF: Pax2 protein regulates expression of secreted frizzled related protein 2 REFERENCE 6 (bases 1 to 4257) AUTHORS Schimmenti,L.A., Manligas,G.S. and Sieving,P.A.
TITLE Optic nerve dysplasia and renal insufficiency in a family with a novel PAX2 mutation, Arg115X: further ophthahnologic delineation of the renal-coloboma syndrome JOURNAL Ophthalmic Genet. 24 (4), 191-202 (2003) REMARK GeneRIF: PAX2 mutation is associated with Optic nerve dysplasia and renal insufficiency of the renal-coloboma syndrome REFERENCE 7 (bases 1 to 4257) AUTHORS Muratovska,A., Zhou,C., He,S., Goodyer,P. and Eccles,M.R.
TITLE Paired-Box genes are frequently expressed in cancer and often required for cancer cell survival JOURNAL Oncogene 22 (39), 7989-7997 (2003) REIVIARK. GeneRIF: The PAX2 gene was frequently expressed in a panel of 406 common primary tumor tissues and endogenous PAX gene expression is often required for the growth and survival of cancer cells REFERENCE 8 (bases 1 to 4257) AUTHORS Gough,S.M., McDonald,M., Chen,X.N., Korenberg,J.R., Neri,A., Kahn,T., Eccles,M.R. and Morris,C.M.
TITLE Refined physical map of the human PAX2/HOX11/NFKB2 cancer gene region at 10q24 and relocalization of the HPV6AI1 viral integration site to 14q13.3-q21.1 JOURNAL BMC Genomics 4(1), (1),9 (2 REFERENCE 9(bases 1 to 4257) AUTHORS Hoffineister,A., Ropolo,A., Vasseur,S., Mallo,G.V., Bodeker,H., Ritz-Laser,B., Dressler,G.R., Vaccaro,M.I., Dagorn,J.C., Moreno,S.
and Iovanna,J.L.
TITLE The HMG-UY-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter JOURNAL J. Biol. Chem. 277 (25), 22314-22319 (2002) REMARK GeneRIF: The HMG-UY-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter.
REFERENCE 10 (bases 1 to 4257) AUTHORS Cai,Y., Lechner,M.S., Nihalani,D., Prindle,M.J., Holzman,L.B. and Dressler,G.R.
TITLE Phosphorylation of Pax2 by the c-Jun N-terminal kinase and enhanced Pax2-dependent transcription activation JOURNAL J. Biol. Chem. 277 (2), 1217-1222 (2002) REFERENCE 11 (bases 1 to 4257) AUTHORS Becker,K., Beales,P.L., Calver,D.M., Matthijs,G. and Mohammed,S.N.
TITLE Okihiro syndrome and acro-renal-ocular syndrome: clinical overlap, expansion of the phenotype, and absence of PAX2 mutations in two new families JOURNAL J. Med. Genet. 39 (1), 68-71 (2002) REMARK GeneRIF: The absence of PAX2 mutations has been identified in two families with histories of clinical overlap of Okihiro and acro-renal-ocular syndromes.
REFERENCE 12 (bases 1 to 4257) AUTHORS Eccles,M.R., He,S., Legge,M., Kumar,R., Fox,J., Zhou,C., French,M.
and Tsai,R.W.
TITLE PAX genes in development and disease: the role of PAX2 in urogenital tract development JOURNAL Int. J. Dev. Biol. 46 (4), 535-544 (2002) REMARK Review article GeneRIF: PAX2 has a role in urogenital tract development and disease [review]
REFERENCE 13 (bases 1 to 4257) AUTHORS Chung,G.W., Edwards,A.O., Schimmenti,L.A., Manligas,G.S., Zhang,Y.H. and Ritter,R. III.
TITLE Renal-coloboma syndrome: report of a novel PAX2 gene mutation JOURNAL Am. J. Ophthalmol. 132 (6), 910-914 (2001) REMARK GeneRIF: The causal relationship between PAX2 gene mutations and renal-coloboma syndrome is further supported REFERENCE 14 (bases 1 to 4257) AUTHORS Nishimoto,K., Iijima,K., Shirakawa,T., Kitagawa,K., Satomura,K., Nakamura,H. and Yoshikawa,N.
TITLE PAX2 gene mutation in a family with isolated renal hypoplasia JOURNAL J. Am. Soc. Nephrol. 12 (8), 1769-1772 (2001) REFERENCE 15 (bases 1 to 4257) AUTHORS Ritz-Laser,B., Estreicher,A., Gauthier,B. and Philippe,J.
TITLE The paired homeodomain transcription factor Pax-2 is expressed in the endocrine pancreas and transactivates the glucagon gene promoter JOURNAL J. Biol. Chem. 275 (42), 32708-32715 (2000) REFERENCE 16 (bases 1 to 4257) AUTHORS Lechner,M.S., Levitan,I. and Dressler,G.R.
TITLE PTIP, a novel BRCT domain-containing protein interacts with Pax2 and is associated with active chromatin JOURNAL Nucleic Acids Res. 28 (14), 2741-2751 (2000) REFERENCE 17 (bases 1 to 4257) AUTHORS Tavassoli,K., Ruger,W. and Horst,J.
TITLE Alternative splicing in PAX2 generates a new reading frame and an extended conserved coding region at the carboxy terminus JOURNAL Hum. Genet. 101 (3), 371-375 (1997) REFERENCE 18 (bases 1 to 4257) AUTHORS Dahl,E., Koseki,H. and Balling,R.
TITLE Pax genes and organogenesis JOURNAL Bioessays 19 (9), 755-765 (1997) REIVIARK Review article REFERENCE 19 (bases 1 to 4257) AUTHORS Schimmenti,L.A., Cunliffe,H.E., McNoe,L.A., Ward,T.A., French,M.C., Shim,H.H., Zhang,Y.H., Proesmans,W., Leys,A., Byerly,K.A., Braddock,S.R., Masuno,M., Imaizumi,K., Devriendt,K. and Eccles,M.R.
TITLE Further delineation of renal-coloboma syndrome in patients with extreme variability of phenotype and identical PAX2 mutations JOURNAL Am. J. Hum. Genet. 60 (4), 869-878 (1997) REFERENCE 20 (bases 1 to 4257) AUTHORS Narahara,K., Baker,E., Ito,S., Yokoyama,Y., Yu,S., Hewitt,D., Sutherland,G.R., Eccles,M.R. and Richards,R.I.
TITLE Localisation of a 10q breakpoint within the PAX2 gene in a patient with a de novo t(10;13) translocation and optic nerve coloboma-renal disease JOURNAL J. Med. Genet. 34 (3), 213-216 (1997) REFERENCE 21 (bases 1 to 4257) AUTHORS Dehbi,M., Ghahremani,M., Lechner,M., Dressler,G. and Pelletier,J.
TITLE The paired-box transcription factor, PAX2, positively modulates expression of the Wilms' tumor suppressor gene (WT1) JOURNAL Oncogene 13 (3), 447-453 (1996) REFERENCE 22 (bases 1 to 4257) AUTHORS Sanyanusin,P., Norrish,J.H., Ward,T.A., Nebel,A., McNoe,L.A. and Eccles,M.R.
TITLE Genomic structure of the human PAX2 gene -- ----- ----- ---- -----JOURNAL Genomics 35 (1), 258-261 (1996) REFERENCE 23 (bases 1 to 4257) AUTHORS Sanyanusin,P., Schimrnenti,L.A., McNoe,L.A., Ward,T.A., Pierpont,M.E., Sullivan,M.J., Dobyns,W.B. and Eccles,M.R.
TITLE Mutation of the PAX2 gene in a family with optic nerve colobomas, renal anomalies and vesicoureteral reflux JOURNAL Nat. Genet. 9(4), 358-364 (1995) REFERENCE 24 (bases 1 to 4257) AUTHORS Ward,T.A., Nebel,A., Reeve,A.E. and Eccles,M.R.
TITLE Alternative messenger RNA forms and open reading frames within an additional conserved region of the human PAX-2 gene JOURNAL Cell Growth Differ. 5(9), 1015-1021 (1994) REFERENCE 25 (bases 1 to 4257) AUTHORS Noll,M.
TITLE Evolution and role of Pax genes JOURNAL Curr. Opin. Genet. Dev. 3 (4), 595-605 (1993) REMARK Review article REFERENCE 26 (bases 1 to 4257) AUTHORS Stapleton,P., Weith,A., Urbanek,P., Kozmik,Z. and Busslinger,M.
TITLE Chromosomal localization of seven PAX genes and cloning of a novel family member, PAX-9 JOURNAL Nat. Genet. 3 (4), 292-298 (1993) REFERENCE 27 (bases 1 to 4257) AUTHORS Pilz,A.J., Povey,S., Gruss,P. and Abbott,C.M.
TITLE Mapping of the human homologs of the murine paired-box-containing genes JOURNAL Mamm. Genome 4(2), 78-82 (1993) REFERENCE 28 (bases.1 to 4257) AUTHORS Eccles,M.R., Wallis,L.J., Fidler,A.E., Spurr,N.K., Goodfellow,P.J.
and Reeve,A.E.
TITLE Expression of the PAX2 gene in human fetal kidney and Wilms' tumor JOURNAL Cell Growth Differ. 3 (5), 279-289 (1992) COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff.
The reference sequence was derived from U45255.1 and BM671839.1.
On Sep 22, 2003 this sequence version replaced gi:4557828.
Summary: PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT 1.
Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.
Transcript Variant: This variant (e) encodes the longest isoform (e).
COMPLETENESS: complete on the 3' end.
FEATUR.ES Location/Qualifiers source 1..4257 /organism="Homo sapiens"
/mol type="mRNA"
/dbxref--"taxon:9606"
/chromosome=" 10"
/map=" 10q24"
gene 1..4257 /gene="PAX2"
/dbxref="GeneID: 5 076"
/db_xref--"HGNC:8616"
/db_xref="M1M:167409"
CDS 687..1982 /gene="PAX2"
/note="PAX2 gene is a member of the paired-box containing genes which encode transcription factors involved in embryonic and fetal development; the gene product is nuclear protein which binds DNA
isoform e is encoded by transcript variant e; paired box homeotic gene 2;
go_component: nucleus [goid 0005634] [evidence IEA];
go_function: ATP binding [goid 0005524] [evidence IEA];
go_function: DNA binding [goid 0003677] [evidence TEA];
go_fitnction: DNA binding [goid 0003677] [evidence TAS]
[pmid 9106533];
go_function: nucleoside diphosphate kinase activity [goid 0004550] [evidence IEA];
go_process: development [goid 0007275] [evidence IEA];
go_process: transcription [goid 0006350] [evidence lEA];
go_process: CTP biosynthesis [goid 0006241] [evidence IEA];
go_process: GTP biosynthesis [goid 0006183] [evidence IEA]; , go_process: UTP biosynthesis [goid 0006228] [evidence IEA];
go_process: axonogenesis [goid 00074091 [evidence TAS]
[pmid 9106533];
go_process: cell differentiation [goid 0030154] [evidence IEA];
go_process: visual perception [goid 0007601] [evidence TAS] [pmid 9106533];
go_process: regulation of transcription, DNA-dependent [goid 0006355] [evidence I]EA];
go_process: transcription from RNA polymerase II promoter [goid 0006366] [evidence TAS] [pmid 8760285]"
/codon_start=l /product="paired box protein 2 isoform e"
/protein id="NP_003981.2"
/db_xref--" GI:34878703"
/dbxref--"GeneID:5076"
/db_xref--"HGNC:8616"
/db xref--"MIM:167409"
/translation="MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDV VRQRIVELAH
QGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKV VDKIAEYK
RQNPTMFAWEIRDRLLAEGICDNDTVPS VSSINRIIRTKVQQPFHPTPDGAGTGVTA
PGHTNPSTASPPVS SASNDPVGSYSINGILGIPRSNGEKRKRDEVEVYTDPAHIRGG
GGLHLV WTLRDV SEGS VPNGDS QS GVD SLRKHLRADTFTQQQLEALDRVFERPSY
PD VFQASEHIKSEQGNEYSLPALTPGLDEVKS SLSASTNPELGSNV S GTQTYPV VTG
RDMASTTLPGYPPHVPPTGQGSYPTS TLAGMVPGSEFS GNPYSHPQYTAYNEAWRF
SNPALLMPPPGPPLPLLPLPMTATSYRGDHIKLQADSFGLHIVPV"
STS 1907..2113 /gene="PAX2"
/standard_name="RH80285"
/db_xre f--"Uni S T S: 8 8 43 7"
STS 3105..3257 /gene="PAX2"
/standard_name="D 10S2478"
/db_xref-'-"UniSTS :74159"
polyA signal 4211..4216 /gene="PAX2"
polyA_signal 4215..4220 /gene="PAX2"
polyA_signal 4222..4227 /gene="PAX2"
polyA site 4240 /gene="PAX2"
ORIGIN
1 aggctccagt ctccggccga gtcttctcgc agccgcaacc cacctggggc cagcccagag 61 ctgccagcgc cgctcggctc cctccctccc tcccggccct tcggccgcgg cggcgtgcgc 121 ctgccttttc cgggggcggg ggcctggccc gcgcgctccc ctcccgcagg cgccacctcg 181 gacatccccg ggattgctac ttctctgcca acttcgccaa ctcgccagca cttggagagg 241 cccggctccc ctcccggcgc cctctgaccg cccccgcccc gcgcgctctc cgaccaccgc 301 ctctcggatg accaggttcc aggggagctg agcgagtcgc ctcccccgcc cagcttcagc 361 cctggctgca gctgcagcgc gagccatgcg cccccagtgc accccggccc ggcccaccgc 421 cccggggcca ttctgctgac cgcccagccc cgagccccga cagtggcaag ttgcggctac 481 tgcagttgca agctccggcc aacccggagg agccccagcg gggagcgcag tgttgcgccc 541 cccgcccccg cgcgccccgc agcagccggg cgttcactca tcctccctcc cccaccgtcc 601 ctcccttttc tcctcaagtc ctgaagttga gtttgagagg cgacacggcg gcggcggccg 661 cgctgctccc gctcctctgc ctccccatgg atatgcactg caaagcagac cccttctccg 721 cgatgcaccc agggcacggg ggtgtgaacc agctcggggg ggtgtttgtg aacggccggc 781 ccctacccga cgtggtgagg cagcgcatcg tggagctggc ccaccagggt gtgcggccct 841 gtgacatctc ccggcagctg cgggtcagcc acggctgtgt cagcaaaatc ctgggcaggt 901 actacgagac cggcagcatc aagccgggtg tgatcggtgg ctccaagccc aaagtggcga 961 cgcccaaagt ggtggacaag attgctgaat acaaacgaca gaacccgact atgttcgcct 1021 gggagattcg agaccggctc ctggccgagg gcatctgtga caatgacaca gtgcccagcg 1081 tctcttccat caacagaatc atccggacca aagttcagca gcctttccac ccaacgccgg 1141 atggggctgg gacaggagtg accgcccctg gccacaccat tgttcccagc acggcctccc 1201 ctcctgtttc cagcgcctcc aatgacccag tgggatccta ctccatcaat gggatcctgg 1261 ggattcctcg ctccaatggt gagaagagga aacgtgatga agttgaggta tacactgatc 1321 ctgcccacat tagaggaggt ggaggtttgc atctggtctg gactttaaga gatgtgtctg 1381 agggctcagt ccccaatgga gattcccaga gtggtgtgga cagtttgcgg aagcacttgc 1441 gagctgacac cttcacccag cagcagctgg aagctttgga tcgggtcttt gagcgtcctt 1501 cctaccctga cgtcttccag gcatcagagc acatcaaatc agaacagggg aacgagtact 1561 ccctcccagc cctgacccct gggcttgatg aagtcaagtc gagtctatct gcatccacca 1621 accctgagct gggcagcaac gtgtcaggca cacagacata cccagttgtg actggtcgtg 1681 acatggcgag caccactctg cctggttacc cccctcacgt gccccccact ggccagggaa 1741 gctaccccac ctccaccctg gcaggaatgg tgcctgggag cgagttctcc ggcaacccgt 1801 acagccaccc ccagtacacg gcctacaacg aggcttggag attcagcaac cccgccttac 1861 taatgccgcc ccccggtccg cccctgccgc tgctgccgct gcctatgacc gccactagtt 1921 accgcgggga ccacatcaag cttcaggccg acagcttcgg cctccacatc gtccccgtct 1981 gaccccaccc cggagggagg gaggaccgac gcgacgcgatgcctcccggc caccgcccca 2041 gcctcacccc atcccacgac ccccgcaacc cttcacatca cccccctcga aggtcggaca 2101 ggacgggtgg agccgtgggc gggaccctca ggcccgggcc cgccgccccc agccccgcct 2161 gccgcccctc cccgcctgcc tggactgcgc ggcgccgtga gggggattcg gcccagctcg 2221 tcccggcctc caccaagcca gccccgaagc ccgccagcca ccctgccgga ctcgggcgcg 2281 acctgctggc gcgcgccgga tgtttctgtg acacacaatc agcgcggacc gcagcgcggc 2341 ccagccccgg gcacccgcct cggacgctcg ggcgccagga ggcttcgctg gaggggctgg 2401 gccaaggaga ttaagaagaa aacgactttc tgcaggagga agagcccgct gccgaatccc 2461 tgggaaaaat tcttttcccc cagtgccagc cggactgccc tcgccttccg ggtgtgccct 2521 gtcccagaag atggaatggg ggtgtggggg tccggctcta ggaacgggct ttgggggcgt 2581 caggtctttc caaggttggg acccaaggat cggggggccc agcagcccgc accgatcgag 2641 ccggactctc ggctcttcac tgctcctcct ggcctgccta gttccccagg gcccggcacc 2701 tcctgctgcg agacccggct ctcagccctg ccttgcccct acctcagcgt ctcttccacc 2761 tgctggcctc ccagtttccc ctcctgccag tccttcgcct gtcccttgac gccctgcatc 2821 ctcctccctg actcgcagcc ccatcggacg ctctcccggg accgccgcag gaccagtttc 2881 catagactgc ggactggggt cttcctccag cagttacttg atgccccctc ccccgacaca 2941 gactctcaat ctgccggtgg taagaaccgg ttctgagctg gcgtctgagc tgctgcgggg 3001 tggaagtggg gggctgccca ctccactcct cccatcccct cccagcctcc tcctccggca 3061 ggaactgaac agaaccacaa aaagtctaca tttatttaat atgatggtct ttgcaaaaag 3121 gaacaaaaca acacaaaagc ccaccaggct gctgctttgt ggaaagacgg tgtgtgtcgt 3181 gtgaaggcga aacccggtgt acataacccc tccccctccg ccccgccccg cccggccccg 3241 tagagtccct gtcgcccgcc ggccctgcct gtagatacgc cccgctgtct gtgctgtgag 3301 agtcgccgct cgctgggggg gaaggggggg acacagctac acgcccatta aagcacagca 3361 cgtcctgggg gaggggggca ttttttatgt tacaaaaaaa aattacgaaa gaaaagaaat 3421 ctctatgcaa aatgacgaac atggtcctgt ggactcctct ggcctgtttt gttggctctt 3481 tctctgtaat tccgtgtttt cgctttttcc tccctgcccc tctctccctc tgcccctctc 3541 tcctctccgc ttctctcccc ctctgtctct gtctctctcc gtctctgtcg ctcttgtctg 3601 tctgtctctg ctctttcctc ggcctctctc cccagacctg gcccggccgc cctgtctccg 3661 caggctagat ccgaggtggc agctccagcc cccgggctcg ccccctcgcg ggcgtgcccc 3721 gcgcgccccg ggcggccgaa ggccgggccg ccccgtcccg ccccgtagtt gctctttcgg 3781 tagtggcgat gcgccctgca tgtctcctca cccgtggatc gtgacgactc gaaataacag 3841 aaacaaagtc aataaagtga aaataaataa aaatccttga acaaatccga aaaggcttgg 3901 agtcctcgcc cagatctctc tcccctgcga gcccttttta tttgagaagg aaaaagagaa 3961 aagagaatcg tttaagggaa cccggcgccc agccaggctc cagtggcccg aacggggcgg 4021 cgagggcggc gagggcgccg aggtccggcc catcccagtc ctgtggggct ggccgggcag 4081 agaccccgga cccaggccca ggcctaacct gctaaatgtc cccggacggt tctggtctcc 4141 tcggccactt tcagtgcgtc ggttcgtttt gattcttttt cttttgtgca cataagaaat 4201 aaataataat aataaataaa gaataaaatt ttgtatgtca aaaaaaaaaa aaaaaaa cn ~ cn U
M
U
U U
U
U
C~7 U
u u tn cn U
U
E-H
M
~ M C~7 U
y U U
U
U ~
[.~ u QD U
M p U C7 d v v ~2 Q
O M M M M
Q,=
M N ~ t O Q' o~o ~D Z
rA Q Q Q Q
N ~ a a a ~a ~
M M M N
~
~D Z ~D Z
0~ w u W
rA
F-Q U
~ U U H U
Cd ~ E-Ui U U
H U
H U F~-+ C7 = ~ H CU7 U C~7 ~
~
r4 cn Z M F~-+ U U
Q
a ~ U U H
p' U L~7 H U
~ a Q q Q
~
Throughout this application, various publications are referenced. The disclosures of these publications in their entireties are hereby incorporated by reference into this application in order to more fully describe the state of the art to which this invention pertains.
References 1. Jemal, A.; Tiwari, R. C.; Murray, T.; Ghafoor, A.; Samuels, A.; Ward, E.;
Feuer, E.
J.; Thun, M. J., Cancer statistics, 2004. CA Cancer J Clin 2004, 54, (1), 8-29.
2. Prasad, M. A.; Trybus, T. M.; Wojno, K. J.; Macoska, J. A., Homozygous and frequent deletion of proximal 8p sequences in human prostate cancers:
identification of a potential tumor suppressor gene site. Genes Chromosomes Cancer 1998, 23, (3), 255-62.
3. McNeel, D. G.; Malkovsky, M., Immune-based therapies for prostate cancer.
Immunology Letters 2005, 96, (1), 3.
4. Tien, A. H.; Xu, L.; Helgason, C. D., Altered Ixnxnunity. Accompanies Disease Progression in a Mouse Model of Prostate Dysplasia. Cancer Res 2005, 65, (7), 2947-2955.
5. Banchereau, J.; Palucka, A. K.; Dhodapkar, M.; Burkeholder, S.; Taquet, N.;
Rolland, A.; Taquet, S.; Coquery, S.; Wittkowski, K. M.; Bhardwaj, N.;
Pineiro, L.;
Steinman, R.; Fay, J., Immune and Clinical Responses in Patients with Metastatic Melanoma to CD34+ Progenitor-derived Dendritic Cell Vaccine. Cancer Res, 2001, 61, (17), 6451-6458.
6. Fong, L.; Brockstedt, D.; Benike, C.; Breen, J. K.; Strang, G.; Ruegg, C.
L.;
Engleman, E. G., Dendritic Cell-Based Xenoantigen Vaccination for Prostate Cancer Irrununotherapy. Jlmrnuraol 2001, 167, (12), 7150-7156.
7. Linzmeier, R.; Ho, C. H.; Hoang, B. V.; Ganz, T., A 450-kb contig of defensin genes on human chromosome 8p23. Gene 1999, 233, (1-2), 205-11.
8. Yang, D.; Biragyn, A.; Hoover, D. M.; Lubkowski, J.; Oppenheim, J. J., Multiple Roles of Antimicrobial Defensins, Cathelicidins, and Eosinophil-Derived Neurotoxin in Host Defense. Annual Review ofImmunology 2004, 22, (1), 181-215.
Inhibition of PAX2 protein expression allows normal DEFB 1 expression.
Figure 12. Illustration of the DEFB1 Reporter Construct. The DEFB1 promoter consisting of the first 160 bases upstream of the mRNA start site was PCR
amplified from DU145 cell and ligated into the pGL3 luciferase reporter plasmid.
Figure 13. Inhibition of PAX2 Results in DEFB1 Expression. DU145, PC3, LNCaP
and HPrEC were treated for 48 hours with PAX2 siRNA. QRT-PCR analysis before treatment showed no DEFB1 expression in DU145, PC3 and LNCaP. However, DEFB1 expression was restored following treatment in all lines. There was no change in DEFB1 expression following siRNA treatment of PAX2-null HprEC.
Figure 14. Inhibition of PAX2 Results in Increased DEFB1 Promoter Activity.
promoter/pGL3 and DU145 promoter/pGL3, construct were generated and were transfected into PC3 and DU145 cells, respectively. Promoter activity was compared before and after PAX2 inhibition by siRNA treatment. DEFB 1 promoter activity increased 2.65-fold in DU145 and 3.78 fold in PC3 following treatment.
Figure 15. DEFB1 Causes Loss of Membrane Integrity. Membrane integrity of PC3 and DU145 cells was analyzed by confocal laser microscopy following the induction of DEFB 1 expression for 48 hours. Green staining was indicative of the localization of AO, and red staining represents EtBr. Yellow staining represents the co-localization of both AO and EtBr in the nucleus.
Figure 16. PAX2 Inhibition Results in Loss of Membrane Integrity. Cells were treated for 48 hours with PAX2 siRNA and membrane integrity was analyzed by confocal laser microscopy.
Figure 17. ChIP Analysis of PAX2 binding to DEFB1 Promoter. ChIP analysis was performed on DU145 and PC3 cells. Following immunoprecipitation with an anti-antibody, PCR was performed to detect the DEFB 1 promoter region containing the GTTCC
PAX2 recognition site. This demonstrates that the PAX2 transcriptional repressor is bound to the DEFB 1 promoter in prostate cancer cell lines.
Figure 18. Predicted Structure of the PrdPD and PrdHD with DNA. The coordinates of the structures of the PrdPD bound to DNA (Xu et al., 1995 and the PrdHD
bound to DNA (Wilson et al., 1995) were used to construct a model of the two domains as they bound to a PHO site. The individual binding sites are abutted next to each other with a specific orientation as indicated. The PAI binding site is in red, the HD
binding site is in blue, and the corresponding PAI domain is in turquoise, and HD is in yellow.
The RED
domain is oriented based on the PrdPD crystal structure.
Figure 19. Comparison of Consensus Sequences of Different Paired Domains. At the top of the Figure is drawn a schematic representation of protein-4:DNA
contacts described in the crystallographic analysis of the Prd-paired-domain -DNA complex [91. Empty boxes indicate a-helices, shaded boxes indicates b-sheets and a thick line indicate a b-turn.
Contacting amino acids are shown by single-letter code. Only direct amino acid base 'contacts are shown. Empty circles indicate major groove contacts while red arrows indicate minor groove contacts. This scheme is aligned to all known consensus sequences for paired-domain proteins (top strands only are shown). Vertical lines between consensus sequences indicate conserved base-pairs. Numbering of the positions is shown at the bottom of the Figure and it is the same as that used in [9]".
DETAILED DESCRIPTION OF THE INVENTION
As shown herein, PAX2 inhibits expression of DEFB 1, and DEFB 1 is shown to have tumor cell killing activity. Thus, provided is a method of treating cancer in a subject by inhibiting expression of PAX2. An example of a cancer treated by the present method is prostate cancer. The present methods are particularly effective for treatment of late stage prostate cancer.
In the cancer treatment methods disclosed, the method of inhibiting expression of PAX 2 can be by administration of a nucleic acid encoding a siRNA for PAX 2.
Dharmachon is a commercial source for such siRNAs.
The siRNA for use in the methods can be selected from the group consisting of:
AUAGACUCGACUUGACUUCUU (SEQ ID NO:2) AUCUUCAUCACGUUUCCUCUU (SEQ ID NO:4) GUAUUCAGCAAUCUUGUCCUU (SEQ ID NO:6) GAUUUGAUGUGCUCUGAUGUU (SEQ ID NO:8) The following table illustrates the above antisense sequences and their corresponding sense sequences.
Sense (5'-3') Antisense (5'-3') Sequence A 5'- GAAGUCAAGUCGAGUCUAUUU-3' 5'-AUAGACUCGACUUGACUUCUU-3' Sequence B 5'-GAGGAAACGUGAUGAAGAUUU-3' 5'-AUCUUCAUCACGUUUCCUCUU-3' Sequence C 5'-GGACAAGAUUGCUGAAUACUU-3' 5'-GUAUUCAGCAAUCUUGUCCUU-3' Sequence D 5'-CAUCAGAGCA-CAUCAAAUCUU-3' 5'-GAUUUGAUGUGCUCUGAUGUU-3' Further examples of molecules that inhibit PAX2 include:
#1 ACCCGACTATGTTCGCCTGG (SEQ ID NO:XXX), #2 AAGCTCTGGATCGAGTCTTTG (SEQ ID NO:XXX), and #4 ATGTGTCAGGCACACAGACG (SEQ ID NO:XXX). #4 was shown to inhibit PAX2 (Davies et al., Hum. Mol. Gen Jan. 15, 13 (2); 235).
. Another paper (Muratovska et al., Paired-Box genes are frequently expressed in cancer and often required for cancer cell survival Oncogene (2003) 22, 7989-7997) discloses the following siRNAs: GUCGAGUCUAUCUGCAUCCTT (SEQ ID NO:xxx) and GGAUGCAGAUAGACUCGACTT (SEQ ID NO:XXX).
To down-regulate Pax2 expression, Fonsato et al. transfected tumor-derived endothelial cells with an anti-sense PAX2 vector. See Fonsato V. et al (Expression of Pax2 in human renal tumor-derived endothelial cells sustains apoptosis resistance and angiogenesis, Am J Pathol. 2006 Feb;168(2):706-1), incorporated herein by referene for its description of this molecule. Similarly, Hueber et al. teach that PAX2 antisense eDNA and PAX2-small interfering RNA (100 nM) reduce endogenous PAX2 protein. See Hueber et al. PAX2 inactivation enhances cisplatin-induced apoptosis in renal carcinoma cells, Kidney Int. 2006 Apr;69(7):1139-45 incorporated herein for its teaching of PAX2 antisense and PAX2 siRNA.
Additional inhibitors of PAX2 expression or the binding of PAX2 to the DEFB 1 promoter are provided to increase DEFB 1 expression in the presently disclosed methods.
For example, small molecules and antibodies are designed based on the present studies to interfere with or inhibit the binding of PAX2 to the DEFB1 promoter.
As shown herein, PAX2 inhibits expression of DEFB 1, and DEFB 1 is shown to have tumor cell killing activity. Thus, a method of treating cancer in a subject by administering DEFB1 is also provided. An example of a cancer treated by the present method is prostate cancer.
Similarly, provided is a method of treating cancer in a subject by increasing expression of DEFB1 in the subject. The present methods of administering or increasing the expression of DEFB1 are particularly effective for treatment of late stage prostate cancer.
In one embodiment of the methods of the invention for treating cancer by administering DEFB 1 or increasing DEFB 1 expression (e.g., by inhibiting expression or binding of PAX2), the subject is a subject diagnosed with prostate cancer. In a further embodiment of the methods of the invention for treating cancer by administering DEFB 1 or increasing DEFB 1 expression (e.g., by inhibiting expression or binding of PAX2), the subject is a subject diagnosed with advanced (late stage) prostate cancer.
In the method wherein the expression of DEFB 1 is increased, it can be increased by blocking the binding of PAX2 to the DEFB 1 promoter. The blocking of binding of PAX2 to the DEFB 1 promoter can be by administration of an oligonucleotide containing the PAX2 DNA binding site of DEFB 1. This oligonucleotide can be complementary to the sequence of PAX2 that binds to the DEFB 1 promoter. Alternatively, the oligonucleotide can interact with the PAX2 in a way that inhibits binding to DEFB 1. This interaction can be based on three-dimensional structure rather than primary nucleotide sequence.
PAX proteins are a family of transcription factors conserved during evolution and able to bind specific DNA sequences through a domains called a "paired domain"
and a "homeodomain". The paired domain (PD) is a consensus sequence shared by certain PAX
proteins (e.g., PAX2 and PAX6). The PD directs DNA binding of amino acids located in the a3-helix forming a DNA-Protein complex. For PAX2, the amino acids in the HD
recognize and interact specifically with a CCTTG DNA core sequence. Therefore, the critical region for PAX2 binding to DEFB 1 would be AAGTTCACCCTTGACTGTG.
Oligonucleotides up to and exceeding 64 bases in length, which include this sequence or its complement are expected to be inhibitors.
The DNA-binding specificity of the PAX-8 paired domain was investigated. Site selection experiments indicate that PAX-8 binds to a consensus sequence similar to those bound by PAX-2 and PAX-5. When consensus sequences of various paired domains are observed in light of recent structural studies describing paired-domain-DNA
interaction [Xu, Rould, Jun, Desplan and Pabo (1995) Cell 80, 639-650], it appears that base-pairs contacted in the minor groove are conserved, while most of the base-pairs contacted in the major groove are not. Therefore a network of specific minor groove contacts is a common characteristic of paired-domain-DNA interactions. The functional importance of such a network can be successfully tested by analyzing the effect of consensus-based mutations on the PAX2 binding site of the DEFB 1 promoter.
The PAX2 DNA binding site of DEFB 1 can comprise SEQ ID NO:1 (CCTTG).
The oligonucleotide comprising to the PAX2 DNA binding site of DEFB 1 is selected from the group consisting of Xl CCTTG (SEQ ID NO:1)X2, wherein Xl is from 1 to 35 contiguous flanking nucleotides of DEFB l and X2 is from 1 to 35 nucleotides. The nucleotides can be contiguous nucleotides that normally flank the PAX2 DNA binding site of DEFB
1.
Alternatively, they can be unrelated to DEFB 1, and selected routinely to avoid interference with the recognition sequence.
For example, the inhibitory oligonucleotides can be selected from the group consisting of:
CTCCCTTCAGTTCCGTCGAC (SEQ II) NO:9) CTCCCTTCACCTTGGTCGAC (SEQ ID NO:10) ACTGTGGCACCTCCCTTCAGTTCCGTCGACGAGGTTGTGC (SEQ ID NO: 12) ACTGTGGCACCTCCCTTCACCTTGGTCGACGAGGTTGTGC (SEQ ID NO: 13) The disclosed compositions can be used to treat any disease where uncontrolled cellular proliferation occurs such as cancers. A non-limiting list of different types of cancers is as follows: lymphomas (Hodgkins and non-Hodgkins), leukemias, carcinomas, carcinomas of solid tissues, squamous cell carcinomas, adenocarcinomas, sarcomas, gliomas, high grade gliomas, blastomas, neuroblastomas, plasmacytomas, histiocytomas, melanomas, adenomas, hypoxic tumors, myelomas, AIDS-related lymphomas or sarcomas, metastatic cancers, or cancers in general.
A representative but non-limiting list of cancers that the disclosed compositions can be used to treat is the following: lymphoma, B cell lymphoma, T cell lymphoma, mycosis fungoides, Hodgkin's Disease, myeloid leukemia, bladder cancer, brain cancer, nervous system cancer, head and neck cancer, squamous cell carcinoma of head and neck, kidney cancer, lung cancers such as small cell lung cancer and non-small cell lung cancer, neuroblastoma/glioblastoma, ovarian cancer, pancreatic cancer, prostate cancer, skin cancer, liver cancer, melanoma, squamous cell carcinomas of the mouth, throat, larynx, and lung, colon cancer, cervical cancer, cervical carcinoma, breast cancer, and epithelial cancer, renal cancer, genitourinary cancer, pulmonary cancer, esophageal carcinoma, head and neck carcinoma, large bowel cancer, hematopoietic cancers; testicular cancer; colon and rectal cancers, prostatic cancer, or pancreatic cancer. Compounds disclosed herein may also be used for the treatment of precancer conditions such as cervical and anal dysplasias, other dysplasias, severe dysplasias, hyperplasias, atypical hyperplasias, and neoplasias. Further, a number of diseases stemming from chronic inflammation, e.g., prostatitis and Benign Prostatic Hypertrophy (BPH), as well as various cancers of the prostate, can be impacted by the present methods and compounds.
DEFB 1's gene locus (8p23.3) is a hotspot for deletions and has been linked to patients with poorer prognosis. Thus, DEFB1 (and perhaps PAX2) can be used as a biomarker, e.g., in a screening for the early detection of prostate cancer.
Furthermore, data presented here indicate that its loss may occur as early as PIN (or even before), and may be ; a major contributing factor to the onset of prostate cancer.
Nucleic Acid Homology/Identity/Similarity It is understood that as discussed herein the use of the terms homology and identity mean the same thing as similarity. Thus, for example, if the use of the word homology is used between two non-natural sequences it is understood that this is not necessarily indicating an evolutionary relationship between these two sequences, but rather is looking at the similarity or relatedness between their nucleic acid sequences. Many of the methods for determining homology between two evolutionarily related molecules are routinely applied to any two or more nucleic acids or proteins for the purpose of measuring sequence similarity regardless of whether they are evolutionarily related or not.
In general, it is understood that one way to define any known variants and derivatives or those that might arise, of the disclosed genes and proteins herein, is through defining the variants and derivatives in terms of homology to specific known sequences.
This identity of particular sequences disclosed herein is also discussed elsewhere herein. In general, variants of genes and proteins herein disclosed typically have at least, about 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99 percent homology to the stated sequence or the native sequence. Those of skill in the art readily understand how to determine the homology of two proteins or nucleic acids, such as genes. For example, the homology can be calculated after aligning the two sequences so that the homology is at its highest level.
Another way of calculating homology can be performed by published algorithms.
Optimal alignment of sequences for comparison may be conducted by the local homology algorithm of Smith and Waterman Adv. Appl. Math. 2: 482 (1981), by the homology alignment algorithm of Needleman and Wunsch, J. MoL Biol. 48: 443 (1970), by the search for similarity method of Pearson and Lipman, Proc. Natl. Acad. Sci. U.S.A. 85:
(1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by inspection.
The same types of homology can be obtained for nucleic acids by for example the algorithms disclosed in Zuker, M. Science 244:48-52, 1989, Jaeger et al. Proc.
Natl. Acad.
Sci. USA 86:7706-7710, 1989, Jaeger et al.lVlethods Enzymol. 183:281-306, 1989 which are herein incorporated by reference for at least material related to nucleic acid alignment. It is understood that any of the methods typically can be used and that in certain instances the results of these various methods may differ, but the skilled artisan understands if identity is found with at least one of these methods, the sequences would be said to have the stated identity, and be disclosed herein.
For example, as used herein, a sequence recited as having a particular percent homology to another sequence refers to sequences that have the recited homology as calculated by any one or more of the calculation methods described above. For example, a first sequence has 80 percent homology, as defined herein, to a second sequence if the first sequence is calculated to have 80 percent homology to the second sequence using the Zuker calculation method even if the first sequence does not have 80 percent homology to the second sequence as calculated by., any of the other calculation methods. As another example, a first sequence has 80 percent homology, as defined herein, to a second sequence if the first sequence is calculated to have 80 percent homology to the second sequence using both the Zuker calculation method and the Pearson and Lipman calculation method even if the first sequence does not have 80 percent homology to the second sequence as calculated by the Smith and Waterman calculation method, the Needleman and Wunsch calculation method, the Jaeger calculation methods, or any of the other calculation methods. As yet another example, a first sequence has 80 percent homology, as defined herein, to a second sequence if the first sequence is calculated to have 80 percent homology to the second sequence using each of calculation methods (although, in practice, the different calculation methods will often result in different calculated homology percentages).
Hybridization/selective hybridization The term hybridization typically means a sequence driven interaction between at least two nucleic acid molecules, such as an oligonucleotide inhibitor, a primer or a probe and a gene. Sequence driven interaction means an interaction that occurs between two nucleotides or nucleotide analogs or nucleotide derivatives in a nucleotide specific manner.
For example, G interacting with C or A interacting with T are sequence driven interactions.
Typically sequence driven interactions occur on the Watson-Crick face or Hoogsteen face of the nucleotide. The hybridization of two nucleic acids is affected by a number of conditions and parameters known to those of skill in the art. For example, the salt concentrations, pH, and temperature of the reaction all affect whether two nucleic acid molecules will hybridize.
Parameters, for selective hybridization between two nucleic acid molecules are well known to those of skill in the art. For example, in some embodiments selective hybridization conditions can be defined as stringent hybridization conditions.
For example, stringency of hybridization is controlled by both temperature and salt concentration of either or both of the hybridization and washing steps. For example, the conditions of hybridization to achieve selective hybridization may involve hybridization in high ionic strength solution (6X SSC or 6X SSPE) at a temperature that is about 12-25 C
below the Tm (the melting temperature at which half of the molecules dissociate from their hybridization partners) followed by washing at a combination of temperature and salt concentration chosen so that the washing temperature is about 5 C to 20 C
below the Tm.
The temperature and salt conditions are readily determined empirically in preliminary experiments in which samples of reference DNA immobilized on filters are hybridized to a labeled nucleic acid of interest and then washed under conditions of different stringencies.
Hybridization temperatures are typically higher for DNA-RNA and RNA-RNA
hybridizations. The conditions can be used as described above to achieve stringency, or as is known in the art. (Sambrook et al., Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, New York, 1989; Kunkel et al.
Methods Enzymol. 1987:154:367, 1987 which is herein incorporated by reference for material at least related to hybridization of nucleic acids). A preferable stringent hybridization condition for a DNA:DNA hybridization can be at about 68 C (in aqueous solution) in 6X SSC or 6X SSPE followed by washing at 68 C. Stringency of hybridization and washing, if desired, can be reduced accordingly as the degree of complementarity desired is decreased, and further, depending upon the G-C or A-T richness of any area wherein variability is searched for. Likewise, stringency of hybridization and washing, if desired, can be increased accordingly as homology desired is increased, and further, depending upon the G-C or A-T richness of any area wherein high homology is desired, all as known in the art.
Another way to define selective hybridization is by lo,oking at the amount (percentage) of one of the nucleic acids bound to the other nucleic acid. For example, in some embodiments selective hybridization conditions would be when at least about, 60, 65, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97; 98, 99, 100 percent of the limiting nucleic acid is bound to the non-limiting nucleic acid. Typically, the non-limiting nucleic acid is in for example, 10 or 100 or 1000 fold excess. This type of assay can be performed at under conditions where both the limiting and non-limiting nucleic acid are for example, 10 fold or 100 fold or 1000 fold below their kd, or where only one of the nucleic acid molecules is 10 fold or 100 fold or 1000 fold or where one or both nucleic acid molecules are above their kd.
Another way to define selective hybridization is by looking at the percentage of nucleic acid that gets enzymatically manipulated under conditions where hybridization is required to promote the desired enzymatic manipulation, e.g., for primers. For example, in some embodiments selective hybridization conditions would be when at least about, 60, 65, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 percent of the primer is enzymatically manipulated under conditions which promote the enzymatic manipulation, for example if the enzymatic manipulation is DNA extension, then selective hybridization conditions would be when at least about 60, 65, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 percent of the primer molecules are extended.
Preferred conditions also include those suggested by the manufacturer or indicated in the art as being appropriate for the enzyme performing the manipulation.
Just as with homology, it is understood that there are a variety of methods herein disclosed for determining the level of hybridization between two nucleic acid molecules. It is understood that these methods and conditions may provide different percentages of hybridization between two nucleic acid molecules, but unless otherwise indicated meeting the parameters of any of the methods would be sufficient. For example if 80%
hybridization was required and as long as hybridization occurs within the required parameters in any one of these methods it is considered disclosed herein.
It is understood that those of skill in the art understand that if a composition or method meets any one of these criteria for determining.hybridization either collectively or singly it is a composition or method that is disclosed herein.
Nucleotides and related molecules A nucleotide is a molecule that contains a base moiety, a sugar moiety and a phosphate moiety.
Nucleotides can be linked together through their phosphate moieties and sugar moieties creating an internucleoside linkage. The base moiety of a nucleotide can be adenin-9-yl (A), cytosin-1-y,l (C), guanin-9-yl (G), uracil-1-yl (U); and thymin-1-yl (T). The sugar moiety of a nucleotide is a ribose or a deoxyribose. The phosphate moiety of a nucleotide is pentavalent phosphate. A
non-limiting example of a nucleotide would be 3'-AMP (3'-adenosine moriophosphate) or 5'-GMP (5'-guanosine monophosphate).
A nucleotide analog is a nucleotide which contains some type of modification to any of the base, sugar, or phosphate moieties. Modifications to the base moiety would include natural and synthetic modifications of A, C, G, and T/U as well as different purine or pyrimidine bases, such as uracil-5-yl (.psi.), hypoxanthin-9-yl (I), and 2-aminoadenin-9-yl.
A modified base includes but is not limited to 5-methylcytosine (5-me-C), 5-hydroxymethyl cytosine, xanthine, hypoxanthine, 2-aminoadenine, 6-methyl and other alkyl derivatives of adenine and guanine, 2-propyl and other alkyl derivatives of adenine and guanine, 2-thiouracil, 2-thiothymine and 2-thiocytosine, 5-halouracil and cytosine, 5-propynyl uracil and cytosine, 6-azo uracil, cytosine and thymine, 5-uracil (pseudouracil), 4-thiouracil, 8-halo, 8-amino, 8-thiol, 8-thioalkyl, 8-hydroxyl and other 8-substituted adenines and guanines, 5-halo particularly 5-bromo, 5-trifluoromethyl and other 5-substituted uracils and cytosines, 7-methylguanine and 7-methyladenine, 8-azaguanine and 8-azaadenine, 7-deazaguanine and 7-deazaadenine and 3-deazaguanine and 3-deazaadenine. Additional base modifications can be found for example in U.S. Pat. No. 3,687,808, Englisch et al., Angewandte Chemie, International Edition, 1991, 30, 613, and Sanghvi, Y. S., Chapter 15, Antisense Research and Applications, pages 289-302, Crooke, S. T. and Lebleu, B. ed., CRC Press, 1993. Certain nucleotide analogs, such as 5-substituted pyrimidines, 6-azapyrimidines and N-2, N-6 and 0-6 substituted purines, including 2-aminopropyladenine, 5-propynyluracil and 5-propynylcytosine. 5-methylcytosine can increase the stability of duplex formation. Often time base modifications can be combined with for example a sugar modification, such as 2'-O-methoxyethyl, to achieve unique properties such as increased duplex stability. There are numerous United States patents such as 4,845,205; 5,130,302; 5,134,066;
5,175,273;
5,367,066; 5,432,272; 5,457,187; 5,459,255; 5,484,908; 5,502,177; 5,525,711;
5,552,540;
5,587,469; 5,594,121, 5,596,091; 5,614,617; and 5,681,941, which detail and describe a range of base modifications. Each of these patents is herein incorporated by reference.
Nucleotide analogs can also include modifications of the sugar moiety.
Modifications to the sugar moiety would include natural modifications of the ribose and deoxyribose as well as synthetic modifications. Sugar modifications include but are not limited to the following modifications at the 2' position: OH; F; 0-, S-, or N-alkyl; 0-, S-, or N-alkenyl; 0-, S- or N-alkynyl; or O-alkyl-O-alkyl, wherein the alkyl, alkenyl and alkynyl may be substituted or unsubstituted Cl to Clo, alkyl or C2 to Clo alkenyl and alkynyl. 2' sugar modifications also include but are not limited to -O[(CH2)õ
O]m CH3, -O(CH2)r, OCH3, -O(CHa)õ NH2, -O(CH2)õ CH3, -O(CHa)n -ONH2, and -O(CHZ)õON[(CH2)õ
CH3)]2, where n and m are from 1 to about 10.
Other modifications at the 2' position include but are not lirnited to: Cl to Clo lower alkyl, substituted lower alkyl, alkaryl, aralkyl, 0-alkaryl or 0-aralkyl, SH, SCH3, OCN, Cl, Br, CN, CF3, OCF3, SOCH3, SOa CH3, ON02, NO2, N3, NH2, heterocycloalkyl, heterocycloalkaryl, aminoalkylamino, polyalkylamino, substituted silyl, an RNA
cleaving group, a reporter group, an intercalator, a group for improving the pharmacokinetic properties of an oligonucleotide, or a group for improving the pharmacodynamic properties of an oligonucleotide, and other substituents having similar properties.
Similar modifications may also be made at other positions on the sugar, particularly the 3' position of the sugar on the 3' terminal nucleotide or in 2'-5' linked oligonucleotides and the 5' position of 5' terminal nucleotide. Modified sugars would also include those that contain modifications at the bridging ring oxygen, such as CH2 and S. Nucleotide sugar analogs may also have sugar mimetics such as cyclobutyl moieties in place of the pentofuranosyl sugar. There are numerous United States patents that teach the preparation of such modified sugar structures such as 4,981,957; 5,118,800; 5,319,080; 5,359,044;
5,393,878; 5,446,137;
5,466,786; 5,514,785; 5,519,134; 5,567,811; 5,576,427; 5,591,722; 5,597,909;
5,610,300;
5,627,053; 5,639,873; 5,646,265; 5,658,873; 5,670,633; and 5,700,920, each of which is herein incorporated by reference in its entirety.
Nucleotide analogs can also be modified at the phosphate moiety. Modified phosphate moieties include but are not limited to those that can be modified so that the linkage between two nucleotides contains a phosphorothioate, chiral phosphorothioate, phosphorodithioate, phosphotriester, aminoalkylphosphotriester, methyl and other alkyl phosphonates including 3'-alkylene phosphonate and chiral phosphonates, phosphinates, phosphoramidates including 3'-amino phosphoramidate and aminoalkylphosphoramidates, thionophosphoramidates, thionoalkylphosphonates, thionoalkylphosphotriesters, and boranophosphates. It is understood that these phosphate or modified phosphate linkage between two nucleotides can be through a 3'-5' linkage or a 2'-5' linkage, and the linkage can contain inverted polarity such as 3'-5' to 5'-3' or 2'-5' to 5'-2'.
Various salts, mixed salts and free acid forms are also included. Numerous United States patents teach how to make and use nucleotides containing modified phosphates and include but are not limited to, 3,687,808; 4,469,863; 4,476,301; 5,023,243; 5,177,196; 5,188,897; 5,264,423;
5,276,019;
5,278,302; 5,286,717; 5,321,131; 5,399,676; 5,405,939; 5,453,496; 5,455,233;
5,466,677;
5,476,925; 5,519,126; 5,536,821; 5,541,306; 5,550,111; 5,563,253; 5,571,799;
5,587,361;
and 5,625,050, each of which is herein incorporated by reference. I
It is understood that nucleotide analogs need only contain a single modification, but may also contain multiple modifications within one of the moieties or between different moieties.
Nucleotide substitutes are molecules having similar functional properties to nucleotides, but which do not contain a phosphate moiety, such as peptide nucleic acid (PNA). Nucleotide substitutes are molecules that will recognize nucleic acids in a Watson-Crick or Hoogsteen manner, but which are linked together through a moiety other than a phosphate moiety. Nucleotide substitutes are able to conform to a double helix type structure when interacting with the appropriate target nucleic acid.
Nucleotide substitutes are nucleotides or nucleotide analogs that have had the phosphate moiety and/or sugar moieties replaced. Nucleotide substitutes do not contain a standard phosphorus atom. Substitutes for the phosphate can be for example, short chain alkyl or cycloalkyl intemucleoside linkages, mixed heteroatom and alkyl or cycloalkyl intemucleoside linkages, or one or more short chain heteroatomic or heterocyclic internucleoside linkages. These include those having morpholino linkages (formed in part from the sugar portion of a nucleoside); siloxane backbones; sulfide, sulfoxide and sulfone backbones;formacetyl and thioformacetyl backbones; methylene fozmacetyl and thioformacetyl backbones; alkene containing backbones; sulfamate backbones;
methyleneimino and inethylenehydrazino backbones; sulfonate and sulfonamide backbones;
amide backbones; and others having mixed N, 0, S and CH2 component parts.
Numerous United States patents disclose how to make and use these types of phosphate replacements and include but are not limited to 5,034,506; 5,166,315; 5,185,444; 5,214,134;
5,216,141;
5,235,033; 5,264,562; 5,264,564; 5,405,938; 5,434,257; 5,466,677; 5,470,967;
5,489,677;
5,541,307; 5,561,225; 5,596,086; 5,602,240; 5,610,289; 5,602,240; 5,608,046;
5,610,289;
5,618,704; 5,623,070; 5,663,312; 5,633,360; 5,677,437; and 5,677,439, each of which is herein incorporated by reference.
It is also understood in a nucleotide substitute that both the sugar and the phosphate moieties of the nucleotide can be replaced, by for example an amide type linkage (aminoethylglycine) (PNA). United States patents 5,539,082; 5,714,331;and 5,719,262 teach how to make and use PNA molecules, each of which is herein incorporated by reference. (See also Nielsen et al., Science, 1991, 254, 1497-1500).
It is also possible to link other types of molecules (conjugates) to nucleotides or nucleotide analogs to enhance for example, cellular uptake. Conjugates can be chemically linked to the nucleotide or nucleotide analogs. Such conjugates include but are not limited to lipid moieties such as a cholesterol moiety (Letsinger et al., Proc. Natl.
Acad. Sci. USA, 1989, 86, 6553-6556), cholic acid (Manoharan et al., Bioorg. Med. Chem. Let., 1994, 4, 1053-1060), a thioether, e.g., hexyl-S-tritylthiol (Manoharan et al., Ann.
N.Y. Acad. Sci., 1992, 660, 306-309; Manoharan et al., Bioorg. Med. Chem. Let., 1993, 3, 2765-2770), a thiocholesterol (Oberhauser et al., Nucl. Acids Res., 1992, 20, 533-538), an aliphatic chain, e.g., dodecandiol or undecyl residues (Saison-Behmoaras et al., EMBO J., 1991, 10, 1111-1118; Kabanov et al., FEBS Lett., 1990, 259, 327-330; Svinarchuk et al., Biochimie, 1993, 75, 49-54), a phospholipid, e.g., di-hexadecyl-rac-glycerol or triethylammonium 1,2-di-0-hexadecyl-rac-glycero-3-H-phosphonate (Manoharan et al., Tetrahedron Lett., 1995, 36, 3651-3654; Shea et al., Nucl. Acids Res., 1990, 18, 3777-3783), a polyamine or a polyethylene glycol chain (Manoharan et al., Nucleosides & Nucleotides, 1995, 14, 969-973), or adamantane acetic acid (Manoharan et al., Tetrahedron Left., 1995, 36, 3651-3654), a palxnityl moiety (Mishra et al., Biochim. Biophys. Acta, 1995, 1264, 229-237), or an octadecylamine or hexylamino-carbonyl-oxycholesterol moiety (Crooke et al., J. Pharmacol. Exp. Ther., 1996, 277, 923-937. Numerous United States patents teach the preparation of such conjugates and include, but are not limited to U.S.
Pat. Nos.
4,828,979; 4,948,882; 5,218,105; 5,525,465; 5,541,313; 5,545,730; 5,552,538;
5,578,717, 5,580,731; 5,580,731; 5,591,584; 5,109,124; 5,118,802; 5,138,045; 5,414,077;
5,486,603;
5,512,439; 5,578,718; 5,608,046; 4,587,044; 4,605,735; 4,667,025; 4,762,779;
4,789,737;
4,824,941; 4,835,263; 4,876,335; 4,904,582; 4,958,013; 5,082,830; 5,112,963;
5,214,136;
5,082,830; 5,112,963; 5,214,136; 5,245,022; 5,254,469; 5,258,506; 5,262,536;
5,272,250;
5,292,873; 5,317,098; 5,371,241, 5,391,723; 5,416,203, 5,451,463; 5,510,475;
5,512,667;
5,514,785; 5,565,552; 5,567,810; 5,574,142; 5,585,481; 5,587,371; 5,595,726;
5,597,696;
5,599,923; 5,599,928 and 5,688,941, each of which is herein incorporated by reference.
A Watson-Crick interaction is at least one interaction with the Watson-Crick face of a nucleotide, nucleotide analog, or nucleotide substitute. The Watson-Crick face of a nucleotide, nucleotide analog, or nucleotide substitute includes the C2, Nl, and C6 positions of a purine based nucleotide, nucleotide analog, or nucleotide substitute and the C2, N3, C4 positions of a pyrimidine based nucleotide, nucleotide analog, or nucleotide substitute.
A Hoogsteen interaction is the interaction that takes place on the Hoogsteen face of a nucleotide or nucleotide analog, which is exposed in the major groove of duplex DNA.
The Hoogsteen face includes the N7 position and reactive groups (NH2 or 0) at the C6 position of purine nucleotides.
Sequences There are a variety of sequences related to the DEFB 1 gene and to the PAX2 transcriptional factor, respectively, having the following GenBank Accession Numbers:
U50930 and NM 003989.1. These sequences and others are herein incorporated by reference in their entireties as well as for individual subsequences contained therein.
The one particular sequence set forth in SEQ ID NO: xxx and having GenBank accessioil number U50930 is used herein as an example to exemplify a source for the disclosed DEFB1 nucleic acids. The one particular sequence set forth in SEQ ID
NO:xxx and having GenBank accession number NM 003989 (see Appendix A).1 is used herein as an example, to exemplify a source for the disclosed PAX2 nucleic acids. Other examples of PAX2 sequences, based on alternative splicing are also found in GenBank. These are variants a-e, shown in Appendices B-F. It is understood that the description related to this sequence is applicable to any sequence related to unless specifically indicated otherwise.
Those of skill in the art understand how to resolve sequence discrepancies and differences and to adjust the compositions and methods relating to a particular sequence to other related sequences. siRNA molecules, competitive inhibitors of DEFBI promoter-PAX2, and primers and/or probes can be designed for any DEFB 1 or PAX2 sequence given the information disclosed herein and known in the art.
Nucleic acid synthesis The nucleic acids, such as, the oligonucleotides to be used as inhibitors can be made =
using standard chemical synthesis methods or can be produced using enzymatic methods or any other known method. Such methods can range from standard enzymatic digestion followed by nucleotide fragment isolation (see for example, Sambrook et al., Molecular Cloning: A Laboratory Manual, 2nd Edition (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989) Chapters 5, 6) to purely synthetic methods, for example, by the cyanoethyl phosphoramidite method using a Milligen or Beckman System 1PIus DNA
synthesizer (for example, Mode18700 automated synthesizer of.Milligen-Biosearch, Burlington, MA or ABI Mode1380B). Synthetic methods useful for making oligonucleotides are also described by Ikuta et al., Ann. Rev. Biochem. 53:323-356 (1984), (phosphotriester and phosphite-triester methods), and Narang et al., Methods Enzymol., 65:610-620 (1980), (phosphotriester method). Protein nucleic acid molecules can be made using known methods such as those described by Nielsen et al., Bioconjug.
Chem. 5:3-7 (1994).
Primers and probes Disclosed are compositions including primers and probes, which are capable of interacting with the DEFB 1 gene as disclosed herein. In certain embodiments the primers are used to support DNA amplification reactions. Typically the primers will be capable of being extended in a sequence specific manner. Extension of a primer in a sequence specific manner includes any methods wherein the sequence and/or composition of the nucleic acid molecule to which the primer is hybridized or otherwise associated directs or influences the composition or sequence of the product produced by the extension of the primer. Extension of the primer in a sequence specific manner therefore includes, but is not limited to, PCR, DNA sequencing, DNA extension, DNA polymerization, RNA transcription, or reverse transcription. Techniques and conditions that amplify the primer in a sequence specific manner are preferred. In certain embodiments the primers are used for the DNA
amplification reactions, such as PCR or direct sequencing. It is understood that in certain embodiments the primers can also be extended using non-enzymatic techniques, where for example, the nucleotides or oligonucleotides used to extend the primer are modified such that they will chemically react to extend the primer in a sequence specific manner.
The size of the primers or probes for interaction with the DEFB 1 or PAX2 gene in certain embodiments can be any size that supports the desired enzymatic manipulation of the priiner, such as DNA amplification or the simple hybridization of the probe or primer.
A typical primer or probe would be at least 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87 , 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450,475, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1250, 1500, 1750, 2000, 2250, 2500, 2750, 3000, 3500, or 4000 nucleotides long.
In other embodiments a primer or probe can be less than or equal to 6, 7, 8, 9, 10, 11, 12 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71; 72,73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1250, 1500, 1750, 2000, 2250, 2500, 2750, 3000, 3500, or 4000 nucleotides long.
The primers for the DEFB 1 or PAX2 gene typically will be used to produce an amplified DNA product that contains the region of the DEFB 1 gene to which PAX2 binds.
In general, typically the size of the product will be such that the size can be accurately determined to within 3, or 2 or 1 nucleotides.
In certain embodiments this product is at least 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1250, 1500, 1750, 2000, 2250, 2500, 2750, 3000, 3500, or 4000 nucleotides long.
In other embodiments the product is less than or equal to 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72; 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1250, 1500, 1750, 2000, 2250, 2500, 2750, 3000, 3500, or 4000 nucleotides long.
Functional Nucleic Acids RNAi It is also understood that the disclosed nucleic acids can be used for RNAi or RNA
interference. It is thought that RNAi involves a two-step mechanism for RNA
interference (RNAi): an initiation step and an effector step. For example, in the first step, input double-stranded (ds) RNA (siRNA) is processed into small fragments, such as 21-23-nucleotide 'guide sequences'. RNA amplification occurs in whole animals. Typically then, the guide RNAs can be incorporated into a protein RNA complex which is capable of degrading RNA, the nuclease complex, which has been called the RNA-induced silencing complex (RISC). This RISC complex acts in the second effector step to destroy mRNAs that are recognized by the guide RNAs through base-pairing interactions. RNAi involves the introduction by any means of double stranded RNA into the cell which triggers events that cause the degradation of a target RNA. RNAi is a form of post-transcriptional gene silencing. In addition to the siRNAs disclosed herein, disclosed are RNA
hairpins that can act in RNAi. For description of making and using RNAi molecules see, e.g., Hammond et al., Nature Rev Gen 2: 110-119 (2001); Sharp, Genes Dev 15: 485-490 (2001), Waterhouse et al., Proc. Natl. Acad. Sci. USA 95(23): 13959-13964 (1998) all of which are incorporated herein by reference in their entireties and at least form material related to delivery and making of RNAi molecules.
RNAi has been shown to work in many types of cells, including mammalian cells.
For work in mammalian cells it is preferred that the RNA molecules which will be used as targeting sequences within the RISC complex are shorter. For example, less than or equal to 50 or 40 or 30 or 29, 28, 27, 26, 25, 24, 23,,22, 21, 20, 19, 18, 17, 16, 15, 14, 13 , 12, 11, or 10 nucleotides in length. These RNA molecules can also have overhangs on the 3' or 5' ends relative to the target RNA wh.ich is to be cleaved. These overhangs can be at least or less than or equal to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, or 20 nucleotides long. RNAi works in mammalian stem cells, such as mouse ES cells. Examples of siRNAs can be found in Table 4.
Functional nucleic acids are nucleic acid molecules that have a specific function, such as binding a target molecule or catalyzing a specific reaction.
Functional nucleic acid molecules can be divided into the following categories, which are not meant to be limiting.
For example, functional nucleic acids include antisense molecules, aptamers, ribozymes, triplex forming molecules, and external guide sequences. The functional nucleic acid molecules can act as effectors, inhibitors, modulators, and stimulators of a specific activity possessed by a target molecule, or the functional nucleic acid molecules can possess a de novo activity independent of any other molecules.
Functional nucleic acid molecules can interact with any macromolecule, such as DNA, RNA, polypeptides, or carbohydrate chains. Thus, functional nucleic acids can interact with mRNA or the genomic DNA of PAX2. Often functional nucleic acids are designed to interact with other nucleic acids based on sequence homology between the target molecule and the functional nucleic acid molecule: In other situations, the specific recognition between the functional nucleic acid molecule and the target molecule is not based on sequence homology between the functional nucleic acid molecule and the target molecule, but rather is based on the formation of tertiary structure that allows specific recognition to take place.
Antisense molecules are designed to interact with a target nucleic acid molecule through either canonical or non-canonical base pairing. The interaction of the antisense molecule and the target molecule is designed to promote the destruction of the target molecule through, for example, RNAseH mediated RNA-DNA hybrid degradation.
Alternatively the antisense molecule is designed to interrupt a processing function that normally woulda take place on the target molecule, such as transcription or replication.
Antisense molecules can be designed based on the sequence of the target molecule.
Numerous methods for optimization of antisense efficiency by finding the most accessible regions of the target molecule exist. Exemplary methods would be in vitro selection experiments and DNA modification studies using DMS and DEPC. It is preferred that antisense molecules bind the target molecule with a dissociation constant (ka)less than or equal to 10-6,10-$, 10"10, or 10-12. A representative sample of methods and techniques which aid in the design and use of antisense molecules can be found in the following non-limiting list of United States patents: 5,135,917, 5,294,533, 5,627,158, 5,641,754, 5,691,317, 5,780,607, 5,786,138, 5,849,903, 5,856,103, 5,919,772, 5,955,590, 5,990,088, 5,994,320, 5,998,602, 6,005,095, 6,007,995, 6,013,522, 6,017,898, 6,018,042, 6,025,198, 6,033,910, 6,040,296, 6,046,004, 6,046,319, and 6,057,437.
Aptaniers are molecules that interact with a target molecule, preferably in a specific way. Typically aptamers are small nucleic acids ranging from 15-50 bases in lengtli that fold into defined secondary and tertiary structures, such as stem-loops or G-quartets.
Aptamers can bind small molecules, such as ATP (United States patent 5,631,146) and theophiline (United States patent 5,580,737), as well as large molecules, such as reverse transcriptase (United States patent 5,786,462) and thrombin (United States patent 5,543,293). Aptamers can bind very tightly with kds from the target molecule of less than 10-12 M. It is preferred that the aptamers bind the target molecule with a kd less than 10"6, 10, 100, or 10-12. Aptamers can bind the target molecule with a very high degree of specificity. For example, aptamers have been isolated that have greater than a 10000 fold difference in binding affinities between the target molecule and another molecule that differ at only a single position on the molecule (United States patent 5,543,293). It is preferred that the aptamer have a kd with the target molecule at ieast 10, 100, 1000, 10,000, or 100,000 fold lower than the ka with a background binding molecule.
Representative examples of how to make and use aptamers to bind a variety of different target molecules can be found in the following non-limiting list of United States patents:
5,476,766, 5,503,978, 5,631,146, 5,731,424, 5,780,228, 5,792,613, 5,795,721, 5,846,713, 5,858,660, 5,861,254, 5,864,026, 5,869,641, 5,958,691, 6,001,988, 6,011,020, 6,013,443, 6,020,130, 6,028,186, 6,030,776, and 6,051,698.
Ribozymes are nucleic acid molecules that are capable of catalyzing a chemical reaction, either intramolecularly or intermolecularly. Ribozymes are thus catalytic nucleic acid. It is preferred that the ribozymes catalyze intermolecular reactions.
There are a number of different types of ribozymes that catalyze nuclease or nucleic acid polymerase type reactions which are based on ribozymes found in natural systems, such as hammerhead ribozymes, (for example, but not limited to the following United States patents: 5,334,711, 5,436,330, 5,616,466, 5,633,133, 5,646,020, 5,652,094, 5,712,384, 5,770,715, 5,856,463, 5,861,288, 5,891,683, 5,891,684, 5,985,621, 5,989,908, 5,998,193, 5,998,203, by Ludwig and Sproat, WO 9858057 by Ludwig and Sproat, and WO 9718312 by Ludwig and Sproat) hairpin ribozymes (for example, but not limited to the following United States patents: 5,631,115, 5,646,031, 5,683,902, 5,712,384, 5,856,188, 5,866,701, 5,869,339, and 6,022,962), and tetrahymena ribozymes (for example, but not limited to the following -United States patents: 5,595,873 and 5,652,107). There are also a number of ribozymes that are not found in natural systems, but which have been engineered to catalyze specific reactions de novo (for example, but not limited to the following United States patents:
5,580,967, 5,688,670, 5,807,718, and 5,910,408). Preferred ribozymes cleave RNA or DNA substrates, and more preferably cleave RNA substrates. Ribozymes typically cleave nucleic acid substrates through recognition and binding of the target substrate with subsequent cleavage. This recognition is often based mostly on canonical or non-canonical base pair interactions. This property makes ribozymes particularly good candidates for target specific cleavage of nucleic acids because recognition of the target substrate is based on the target substrates sequence.' Representative,examples of how to make and use ribozymes to catalyze a variety of different reactions can be found in the following non-limiting list of United States patents: 5,646,042, 5,693,535, 5,731,295, 5,811,300, 5,837,855, 5,869,253, 5,877,021, 5,877,022, 5,972,699, 5,972,704, 5,989,906, and 6,017,756.
Triplex forming functional nucleic acid molecules are molecules that can interact with either double-stranded or single-stranded nucleic acid. When triplex molecules interact with a target region, a structure called a triplex is formed, in which there three strands of DNA are forming a complex dependant on both Watson-Crick and Hoogsteen base-pairing. Triplex molecules are preferred because they can bind target regions with high affinity and specificity. It is preferred that the triplex forming molecules bind the target molecule with a kd less than 10"6, 10-8, 10"10, or 10"12 .
Representative examples of how to make and use triplex fonning molecules to bind a variety of different target molecules can be found in the following non-limiting list of United States patents:
5,176,996, 5,645,985, 5,650,316, 5,683,874, 5,693,773, 5,834,185, 5,869,246, 5,874,566, and 5,962,426.
External guide sequences (EGSs) are molecules that bind a target nucleic acid molecule forming a complex, and this complex is recognized by. RNase P, which cleaves the target molecule. EGSs can be designed to specifically target a RNA molecule of choice.
RNAse P aids in processing transfer RNA (tRNA) within a cell. Bacterial RNAse P can be recruited to cleave virtually any RNA sequence by using an EGS that causes the target RNA:EGS complex to mimic the natural tRNA substrate. (WO 92/03566 by Yale, and Forster and Altman, Science 238:407-409 (1990)).
Similarly, eukaryotic EGS/RNAse P-directed cleavage of RNA can be utilized to cleave desired targets within eukaryotic cells. (Yuan et al., Proc. Natl.
Acad. Sci. USA
89:8006-8010 (1992); WO 93/22434 by Yale; WO 95/24489 by Yale; Yuan and Altman, EMBO J 14:159-168 (1995), and Carrara et al., Proc. Natl. Acad. Sci. (USA) 92:2627-2631 (1995)). Representative examples of how to make and use EGS molecules to facilitate cleavage of a variety of different target molecules be found in the following non-limiting list of United States patents: 5,168,053, 5,624,824, 5,683,873, 5,728,521, 5,869,248, and 5,877,162.
Delivery of the compositions to cells There are a number of compositions and methods which can be used to deliver nucleic acids to cells, either in vitro or in vivo. These methods and compositions can largely be broken down into two classes: viral based delivery systems and non-viral based delivery systems. For example, the nucleic acids can be delivered through a number of direct delivery systems such as, electroporation, lipofection, calcium phosphate precipitation, plasmids, viral vectors, viral nucleic acids, phage nucleic acids, phages, cosmids, or via transfer of genetic material in cells or carriers such as cationic liposomes.
Appropriate means for transfection, including viral vectors, chemical transfectants, or physico-mechanical methods such as electroporation and direct diffusion of DNA, are described by, for example, Wolff, J. A., et al., Science, 247, 1465-1468, (1990); and Wolff, J. A. Nature, 352, 815-818, (1991)Such methods are well known in the art and readily adaptable for use with the compositions and methods described herein. In certain cases, the methods will be modified to specifically function with large DNA molecules.
Further, these methods can be used to target certain diseases and cell populations by using the targeting characteristics of the carrier.
Nucleic acid based delivery systems Transfer vectors can be any nucleotide construction used to deliver genes into cells (e.g., a plasmid), or as part of a general strategy to deliver genes, e.g., as part of recombinant retrovirus or adenovirus (Ram et al. Cancer Res. 53:83-88, (1993)).
As used herein, plasmid or viral vectors are agents that transport the disclosed nucleic acids, such as DEFBl coding sequences, PAX2 siRNAs or other antisense molecules into the cell without degradation and include a promoter yielding expression of the gene in the cells into which it is delivered. Viral vectors are, for example, Adenovirus, Adeno-associated virus, Herpes virus, Vaccinia virus, Polio virus, AIDS virus, neuronal trophic virus, Sindbis and other RNA viruses, including these viruses with the HIV
backbone. Also preferred are any viral families which share the properties of these viruses which make them suitable for use as vectors. Retroviruses include Murine Maloney Leukemia virus, MMLV, and retroviruses that express the desirable properties of MMLV as a vector. Retroviral vectors are able to carry a larger genetic payload, i.e., a transgene or marker gene, than other viral vectors, and for this reason are a commonly used vector.
However, they are not as useful in non-proliferating cells. Adenovirus vectors are relatively stable and easy to work with, have high titers, and can be delivered in aerosol formulation, and can transfect non-dividing cells. Pox viral vectors are large and have several sites for inserting genes, they are thermostable and can be stored at room temperature.
A preferred embodiment is.a viral vector which has been engineered so as to suppress the immune response of the host organism, elicited by the viral antigens. Preferred vectors of this type will carry coding regions for Interleukin 8 or 10.
Viral vectors can have higher transaction (ability to introduce genes) abilities than chemical or physical methods to introduce genes into cells. Typically, viral vectors contain, nonstructural early genes, structural late genes, an RNA polymerase III
transcript, inverted terminal repeats necessary for replication and encapsidation, and promoters to control the transcription and replication of the viral genome. When engineered as vectors, viruses typically have one or more of the early genes removed and a gene or gene/promotor cassette is inserted into the viral genome in place of the removed viral DNA.
Constructs of this type can carry up to about 8 kb of foreign genetic material. The necessary functions of the removed early genes are typically supplied by cell lines which have been engineered to express the gene products of the early genes in trans.
Retroviral Vectors A retrovirus is an animal virus belonging to the virus family of Retroviridae, including any types, subfamilies, genus, or tropisms. Retroviral vectors, in general, are described by Verma, I.M., Retroviral vectors for gene transfer. In Microbiology-1985, American Society for Microbiology, pp. 229-232, Washington, (1985), which is incorporated by reference herein. Examples of methods for using retroviral vectors for gene therapy are described in U.S. Patent Nos. 4,868,116 and 4,980,286; PCT
applications WO
90/02806 and WO 89/07136; and Mulligan, (Science 260:926-932 (1993)); the teachings of which are incorporated herein by reference.
A retrovirus is essentially a package which has packed into it nucleic acid cargo.
The nucleic acid cargo carries with it a packaging signal, which ensures that the replicated daughter molecules will be efficiently packaged within the package coat. In addition to the package signal, there are a number of molecules which are needed in cis, for the replication, and packaging of the replicated virus. Typically a retroviral genome, contains the gag, pol, and env genes which are involved in the making of the protein coat. It is the gag, pol, and env genes which are typically replaced by the foreign DNA that it is to be transferred to the target cell. Retrovirus vectors typically contain a packaging signal for incorporation into the package coat, a sequence which signals the start of the gag transcription unit, elements necessary for reverse transcription, including a primer binding site to bind the tRNA primer of reverse transcription, terminal repeat sequences that guide the switch of RNA strands during DNA synthesis, a purine rich sequence 5' to the 3' LTR that serve as the priming site for the synthesis of the second strand of DNA synthesis, and specific sequences near the ends of the LTRs that enable the insertion of the DNA state of the retrovirus to insert into the host genome. The removal of the gag, pol, and env genes allows for about 8 kb of foreign sequence to be inserted into the viral genome, become reverse transcribed, and upon replication be packaged into a new retroviral particle. This amount of nucleic acid is sufficient for the delivery of a one to many genes depending on the size of each transcript.
It is preferable to include either positive or negative selectable markers along with other genes in the insert.
Since the replication machinery and packaging proteins in most retroviral vectors have been removed (gag, pol, and env), the vectors are typically generated by placing them into a packaging cell line. A packaging cell line is a cell line which has been transfected or transformed with a retrovirus that contains the replication and packaging machinery, but lacks any packaging signal. When the vector carrying the DNA of choice is transfected into these cell lines, the vector containing the gene of interest is replicated and packaged into new retroviral particles, by the machinery provided in cis by the helper cell.
The genomes for the machinery are not packaged because they lack the necessary signals.
Adenoviral Vectors The construction of replication-defective adenoviruses has been described (Berkner et al., J. Virology 61:1213-1220 (1987); Massie et al., Mol. Cell. Biol.
6:2872-2883 (1986); Haj-Ahmad et al., J. Virology 57:267-274 (1986); Davidson et al., J.
Virology 61:1226-1239 (1987); Zhang "Generation and identification of recombinant adenovirus by liposome-mediated transfection and PCR analysis" BioTechniques 15:868-872 (1993)).
The benefit of the use of these viruses as vectors is that they are limited in the extent to which they can spread to other cell types, since they can replicate within an initial infected cell, but are unable to form new infectious viral particles. Recombinant adenoviruses have been shown to achieve high efficiency gene transfer after direct, in vivo delivery to airway epithelium, hepatocytes, vascular endothelium, CNS parenchyma and a number of other tissue sites (Morsy, J. Clin. Invest. 92:1580-1586 (1993); Kirshenbaum, J.
Clin. Invest.
92:381-387 (1993); Roessler, J. Clin. Invest. 92:1085-1092 (1993); Moullier, Nature Genetics 4:154-159 (1993); La Salle, Science 259:988-990 (1993); Gomez-Foix, J. Biol.
Chem. 267:25129-25134 (1992); Rich, Human Gene Therapy 4:461-476 (1993);
Zabner, Nature Genetics 6:75-83 (1994); Guzman, Circulation Research 73:1201-1207 (1993);
Bout, Human Gene Therapy 5:3-10 (1994); Zabner, Cell 75:207-216 (1993);
Caillaud, Eur. J. Neuroscience 5:1287-1291(1993); and Ragot, J. Gen. Virology 74:501-507 (1993)).
Recombinant adenoviruses achieve gene transduction by binding to specific cell surface receptors, after which the virus is internalized by, receptor-mediated endocytosis, in the same manner as wild type or replication-defective adenovirus (Chardonnet and Dales, Virology 40:462-477 (1970); Brown and Burling.ham, J. Virology 12:386-396 (1973);
Svensson and Persson, J. Virology 55:442-449 (1985); Seth, et al., J. Virol.
51:650-655 (1984); Seth, et al., Mol. Cell. Biol. 4:1528-1533 (1984); Varga et al., J.
Virology 65:6061-6070 (1991); Wickham et al., Cell 73:309-319 (1993)).
A viral vector can be one based on an adenovirus which has had the El gene removed and these virions are generated in a cell line such as the human 293 cell line. In another preferred embodiment both the El and E3 genes are removed from the adenovirus genome.
Adeno-associated viral vectors Another type of viral vector is based on an adeno-associated virus (AAV). This defective parvovirus is a preferred vector because it can infect many cell types and is nonpathogenic to humans. AAV type vectors can transport about 4 to 5 kb and wild type AAV is known to stably insert into chromosome 19. Vectors which contain this site specific integration property are preferred. An especially preferred embodiment of this type of vector is the P4.1 C vector produced by Avigen, San Francisco, CA, which can contain the herpes simplex virus thymidine kinase gene, HSV-tk, and/or a marker gene, such as the gene encoding the green fluorescent protein, GFP.
In another type of AAV virus, the AAV contains a pair of inverted terminal repeats (ITRs) which flank at least one cassette containing a promoter which directs cell-specific expression operably linked to a heterologous gene. Heterologous in this context refers to any nucleotide sequence or gene which is not native to the AAV or B 19 parvovirus.
Typically the AAV and B 19 coding regions have been deleted, resulting in a safe, noncytotoxic vector. The AAV ITRs, or modifications thereof, confer infectivity and site-specific integration, but not cytotoxicity, and the promoter directs cell-specific expression.
United states Patent No. 6,261,834 is herein incorporated by reference for material related to the AAV vector.
1. The disclosed vectors thus provide DNA molecules which are capable of integration into a mammalian chromosome without substantial toxicity.
2. The inserted genes in viral and retroviral usually contain promoters, and/or enhancers to,help control the expression of the desired gene product. A
promoter is generally a sequence or sequences of DNA that function when in a relatively fixed location in regard to the transcription startsite. A promoter contains core elements required for basic interaction of RNA polymerase and transcription factors, and may contain upstream elements and response elements.
Large payload viral vectors Molecular genetic experiments with large human herpes viruses have provided a means whereby large heterologous DNA fragments can be cloned, propagated and established in cells permissive for infection with herpes viruses (Sun et al., Nature genetics 8: 33-41, 1994; Cotter and Robertson, Curr Opin Mol Ther 5: 633-644, 1999).
These large DNA viruses (herpes simplex virus (HSV) and Epstein-Barr virus (EBV), have the potential to deliver fragments of human heterologous DNA > 150 kb to specific cells. EBV
recombinants can maintain large pieces of DNA in the infected B-cells as episomal DNA.
Individual clones carried human genomic inserts up to 330 kb appeared genetically stable The maintenance of these episomes requires a specific EBV nuclear protein, EBNAl, constitutively expressed during infection with EBV. Additionally, these vectors can be used for transfection, where large amounts of protein can be generated transiently in vitro.
Herpesvirus amplicon systems are also being used to package pieces of DNA >
220 kb and to infect cells that can stably maintain DNA as episomes.
Other useful systems include, for example, replicating and host-restricted non-replicating vaccinia virus vectors.
Non-nucleic acid based systems The disclosed compositions can be delivered to the target cells in a variety of ways.
For example, the compositions can be delivered through electroporation, or through lipofection, or through calcium phosphate precipitation. The delivery mechanism chosen will depend in part on the type of cell targeted and whether the delivery is occurring for example in vivo or in vitro.
Thus, the compositions can comprise, in addition to the disclosed vectors for example, lipids such as liposomes, such as cationic liposomes (e.g., DOTMA, DOPE, and DC-cholesterol) or anionic liposomes. Liposomes can fi.u-ther comprise proteins to facilitate targeting a particular cell, if desired. Administration of a composition comprising a compound and a cationic liposome can be administered to the blood afferent to a target organ or inhaled into the respiratory tract to target cells of the respiratory tract. Regarding liposomes, see, e.g., Brigham et al. Am. J. Resp. Cell. Mol. Biol. -1:95-100 (1989); Felgner et al. Proc. Natl. Acad. Sci USA 84:7413-7417 (1987); U.S. Pat. No.4,897,355.
Furthermore, the compound can be administered as a component of a microcapsule that can be targeted to specific cell types, such as macrophages, or where the diffusion of the compound or delivery of the compound from the microcapsule is designed for a specific rate or dosage.
In the methods described above which include the administration and uptake of exogenous DNA into the cells of a subject (i.e., gene transduction or transfection), delivery of the compositions to cells can be via a variety of mechanisms. As one example, delivery can be via a liposome, using commercially available liposome preparations such as LIPOFECTIN, LIPOFECTAMINE (GIBCO-BRL, Inc., Gaithersburg, MD), SUPERFECT
(Qiagen, Inc. Hilden, Germany) and TRANSFECTAM (Promega Biotec, Inc., Madison, WI), as well as other liposomes developed according to procedures standard in the art. In addition, the disclosed nucleic acid or vector can be delivered in vivo by electroporation, the technology for which is available from Genetronics, Inc. (San Diego, CA) as well as by means of a SONOPORATION machine (ImaRx Pharmaceutical Corp., Tucson, AZ).
The materials may be in solution, suspension (for example, incorporated into microparticles, liposomes, or cells). These may be targeted to a particular cell type via antibodies, receptors, or receptor ligands. The following references are examples of the use of this technology to target specific proteins to tumor tissue (Senter, et al., Bioconiugate Chem., 2:447-451, (1991); Bagshawe, K.D., Br. J. Cancer, 60:275-281, (1989);
Bagshawe, et al., Br. J. Cancer, 58:700-703, (1988); Senter, et al., Bioconjugate Chem., 4:3-9, (1993);
Battelli, et al., Cancer Immunol. Immunother., 35:421-425, (1992); Pietersz and McKenzie, Immunolog. Reviews, 129:57-80, (1992); and Roffler, et al., Biochem.
Pharmacol, 42:2062-2065, (1991)). These techniques can be used for a variety of other specific cell types. Vehicles such as "stealth" and other antibody conjugated liposomes (including lipid mediated drug targeting to colonic carcinoma), receptor mediated targeting of DNA through cell specific ligands, lymphocyte directed tumor targeting, and highly specific therapeutic retroviral targeting of murine glioma cells in vivo. The following references are examples of the use of this technology to target specific proteins to tumor tissue (Hughes et al., Cancer Research, 49:6214-6220, (1989); and Litzinger and Huang, Biochimica et Biophysica Acta, 1104:179-187, (1992)). In general,-receptors are involved in pathways of endocytosis, either constitutive or ligand induced. These receptors cluster in clathrin-coated pits, enter the cell via clathrin-coated vesicles, pass through an acidified endosome in which the receptors are sorted, and then either recycle to the cell surface, become stored intracellular, or are degraded in lysosomes. The internalization pathways serve a variety of functions, such as nutrient uptake, removal of activated proteins, clearance of macromolecules, opportunistic entry of viruses and toxins, dissociation and degradation of ligand, and receptor-level regulation. Many receptors follow more than one intracellular pathway, depending on the cell type, receptor concentration, type of ligand, ligand valency, and ligand concentration. Molecular and'cellular mechanisms of receptor-mediated endocytosis has been reviewed (Brown and Greene, DNA and Cell Biology 10:6, (1991)).
Nucleic acids that are delivered to cells which are to be integrated into the host cell genome, typically contain integration sequences. These sequences are often viral related sequences, particularly when viral based systems are used. These viral integration systems can also be incorporated into nucleic acids which are to be delivered using a non-nucleic acid based system of deliver, such as a liposome, so that the nucleic acid contained in the delivery system can be come integrated into the host genome.
Other general techniques for integration into the host genome include, for example, systems designed to promote homologous recombination with the host genome.
These systems typically rely on sequence flanking the nucleic acid to be expressed that has enough homology with a target sequence within the host cell genome that recombination between the vector nucleic acid and the target nucleic acid takes place, causing the delivered nucleic acid to be integrated into the host genome. These systems and the methods necessary to promote homologous recombination are known to those of skill in the art.
In vivo/ex vivo As described herein, the compositions can be administered in a pharmaceutically acceptable carrier and can be delivered to the subject's cells in vivo and/or ex vivo by a variety of mechanisms well known in the art (e.g., uptake of naked DNA, liposome fusion, intramuscular-injection of DNA via a gene gun, endocytosis and the like).
If ex vivo methods are employed, cells or tissues can be removed and maintained outside the body according to standard protocols well known in the art. The compositions can be introduced into the cells via any gene transfer mechanism, such as, for example, calcium phosphate mediated gene delivery, electroporation, microinjection or proteoliposomes. The transduced cells can then be infused (e.g., in a pharmaceutically acceptable carrier) or homotopically transplanted back into the subject per standard methods for the cell or tissue type. Standard methods are known for transplantation or infusion of various cells into a subject.
Expression systems The nucleic acids that are delivered to cells typically contain expression controlling systems. For example, the inserted genes in viral and retroviral systems usually contain promoters, and/or enhancers to help control the expression of the desired gene product. A
promoter is generally a sequence or sequences of DNA that function when in a relatively fixed location in regard to the transcription start site. A promoter contains core elements required for basic interaction of RNA polymerase and transcription factors, and may contain upstream elements and response elements.
Viral Promoters and Enhancers Preferred promoters controlling transcription from vectors in mammalian host cells may be obtained from various sources, for example, the genomes of viruses such as:
polyoma, Simian Virus 40 (SV40), adenovirus, retroviruses, hepatitis-B virus and most preferably cytomegalovirus, or from heterologous mammalian promoters, e.g.
beta actin promoter. The early and late promoters of the SV40 virus are conveniently obtained as an SV40 restriction fragment which also contains the SV40 viral origin of replication (Fiers et al., Nature, 273: 113 (1978)). The immediate early promoter of the human cytomegalovirus is conveniently obtained as a HindIII E restriction fragment (Greenway, P.J. et al., Gene 18: 355-360 (1982)). Of course, promoters from the host cell or related species also are useful herein.
Enhancer generally refers to a sequence of DNA that functions at no fixed distance from the transcription start site and can be either 5' (Laimins, L. et al., Proc. Nati. Acad.
Sci. 78: 993 (1981)) or 3' (Lusky, M.L., et al., Mol. Cell Bio. 3: 1108 (1983)) to the transcription unit. Furthermore, enhancers can be within an intron (Banerji, J.L. et al., Cell 33: 729 (1983)) as well as within the coding sequence itself (Osborne, T.F., et al., Mol. Cell Bio: 4: 1293 (1984)). They are usually between 10 and 300 bp in length, and they function;
in cis. Enhancers function to increase transcription from nearby promoters.
Enhancers also often contain response elements that mediate the regulation of transcription.
Promoters can also contain response elements that mediate the regulation of transcription.
Enhancers often determine the regulation of expression of a gene. While many enhancer sequences are now known from mammalian genes (globin, elastase, albumin, -fetoprotein and insulin), typically one will use an enhancer from a eukaryotic cell virus for general expression.
Preferred examples are the SV40 enhancer on the late side of the replication origin (bp 100-270), the cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers.
The promotor and/or enhancer may be specifically activated either by light or specific chemical events which trigger their fun.ction. Systems can be regulated by reagents such as tetracycline and dexamethasone. There are also ways to enhance viral vector gene expression by exposure to irradiation, such as gamma irradiation, or alkylating chemotherapy drugs.
In certain embodiments the promoter and/or enhancer region can act as a constitutive promoter and/or enhancer to maximize expression of the region of the transcription unit to be transcribed. In certain constructs the promoter and/or enhancer region be active in all eukaryotic cell types, even if it is only expressed in a particular type of cell at a particular time. A preferred promoter of this type is the CMV
promoter (650 bases). Other preferred promoters are SV40 promoters, cytomegalovirus (full length promoter), and retroviral vector LTR.
It has been shown that all specific regulatory elements can be cloned and used to construct expression vectors that are selectively expressed in specific cell types such as melanoma cells. The glial fibrillary acetic. protein (GFAP) promoter has been used to selectively express genes in cells of glial origin.
Expression vectors used in eukaryotic host cells (yeast, fungi, insect, plant, animal, human or nucleated cells) may also contain sequences necessary for the termination of transcription which may affect mRNA expression. These regions are transcribed as polyadenylated segments in the untranslated portion of the mRNA encoding tissue factor protein. The 3' untranslated regions also include transcription termination sites. It is preferred that the transcription unit also contain a polyadenylation region.
One benefit of this region is that it increases the likelihood that the transcribed unit will be processed and transported like mRNA. The identification and use of polyadenylation signals in expression constructs is well established. It is preferred that homologous polyadenylation signals be used in the transgene constructs. In certain transcription units, the polyadenylation region is derived from the SV40 early polyadenylation signal and consists of about 400 bases. It is also preferred that the transcribed units contain other standard sequences alone or in combination with the above sequences improve expression from, or stability of, the construct.
Proteins Protein variants Variants of the DEFB1 protein are provided. Derivatives of the DEFBI protein function in the disclosed methods and compositions. Protein variants and derivatives are well understood to those of skill in the art and in can involve amino acid sequence modifications. For example, amino acid sequence modifications typically fall into one or more of three classes: substitutional, insertional or deletional variants.
Insertions include amino and/or carboxyl terminal fusions as well as intrasequence insertions of single or multiple amino acid residues. Insertions ordinarily will be smaller insertions than those of ainino or carboxyl terminal fusions, for example, on the order of one to four residues.
Immunogenic fusion protein derivatives, such as those described in the examples, are made by fusing a polypeptide sufficiently large to confer immunogenicity to the target sequence by cross-linking in vitro or by recombinant cell culture transformed with DNA
encoding the fusion. Deletions are characterized by the removal of one or more amino acid residues from the protein sequence. Typically, no more than about from 2 to 6 residues are deleted at any one site within the protein molecule. These variants ordinarily are prepared by site specific mutagenesis of nucleotides in the DNA encoding the protein, thereby producing DNA
encoding the variant, and thereafter expressing the DNA in recombinant cell culture.
Techniques for making substitution mutations at predetermined sites in DNA
having a known sequence are well known, for example M13 primer mutagenesis and PCR
mutagenesis. Amino acid substitutions are typically of single residues, but can occur at a number of different locations at once; insertions usually will be on the order of about from 1 to 10 amino acid residues; and deletions will range about from I to 30 residues. Deletions or insertions preferably are made in adjacent pairs, i.e. a deletion of 2 residues or insertion of 2 residues. Substitutions, deletions, insertions or any combination thereof may be combined to amve at a final construct. The mutations must not place the sequence out of reading frame and preferably, will not create complementary regions that could produce secondary mRNA structure. Substitutional variants are those in which at least one residue has been removed and a different residue inserted in its place. Such substitutions generally are made in accordance with the following Tables 1 and 2 and are referred to as conservative substitutions.
TABLE 1:Amino Acid Abbreviations Amino Acid Abbreviations alanine AlaA
allosoleucine AIle arginine ArgR
asparagine AsnN
aspartic acid AspD
cysteine CysC
glutamic acid GluE
Amino Acid Abbreviations glutamine G1nK
glycine G1yG
histidine HisH
isolelucine IleI
leucine LeuL
lysine LysK
phenylalanine PheF
proline ProP
pyroglutamic Glu acidp serine SerS
threonine ThrT
tyrosine TyrY
tryptophan TrpW
valine VaIV
TABLE 2: Amino Acid Substitutions Original Residue Exemplary Conservative Substitutions, others are known in the art.
Alaser Arglys, gln Asngln; his Aspglu Cysser Glnasn,lys Gluasp Glypro Hisasn;gln Ileleu; val Leuile; val Lysarg; gln;
MetLeu; ile Phemet; leu; tyr Serthr Thrser Trptyr Tyrtrp; phe Valile; leu Substantial changes in function or immunological identity are made by selecting substitutions that are less conservative than those in Table 2, i.e., selecting residues that differ more significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site or (c) the bulk of the side chain. The substitutions which in general are expected to produce the greatest changes in the protein properties will be those in which (a) a hydrophilic residue, e.g.
seryl or threonyl, is substituted for (or by) a hydrophobic residue, e.g. leucyl, isoleucyl, phenylalanyl, valyl or alanyl; (b) a cysteine or proline is substituted for (or by) any other residue; (c) a residue having an electropositive side chain, e.g., lysyl, arginyl, or histidyl, is substituted for (or by) an electronegative residue, e.g., glutamyl or aspartyl; or (d) a residue having a bulky side chain, e.g., phenylalanine, is substituted for (or by) one not having a side chain, e.g., glycine, in this case, (e) by increasing the number of sites for sulfation and/or glycosylation.
For example, the replacement of one amino acid residue with another that is biologically and/or chemically similar is known to those skilled in the art as a conservative substitution. For example, a conservative substitution would be replacing one hydrophobic residue for another, or one polar residue for another. The substitutions include combinations such as, for example, Gly, Ala; Val, Ile, Leu; Asp, Glu; Asn, Gln; Ser, Thr;
Lys, Arg; and Phe, Tyr. Such conservatively substituted variations of each explicitly disclosed sequence are included within the mosaic polypeptides provided herein.
Substitutional or deletional mutagenesis can be employed to insert sites for N-glycosylation (Asn-X-Thr/Ser) or 0-glycosylation (Ser or Thr). Deletions of cysteine or other labile residues also may be desirable. Deletions or substitutions of potential proteolysis sites, e.g. Arg, is accomplished for example by deleting one of the basic residues or substituting one by glutaminyl or histidyl residues.
Certain post-translational derivatizations are the result of the action of recombinant host cells on the expressed polypeptide. Glutaminyl and asparaginyl residues are frequently post-translationally deamidated to the corresponding glutamyl and asparyl residues.
Alternatively, these residues are deamidated under mildly acidic conditions.
Other post-translational modifications include hydroxylation of proline and lysine, phosphorylation of hydroxyl groups of seryl or threonyl residues, methylation of the o-amino groups of lysine, arginine, and histidine side chains (T.E. Creighton, Proteins: Structure and Molecular Properties, W. H. Freeman & Co., San Francisco pp 79-86 [1983]), acetylation of the N-terminal amine and, in some instances, amidation of the C-terminal carboxyl.
It is understood that one way to define the variants and derivatives of the disclosed proteins herein is through defining the variants and derivatives in terms of homology/identity to specific known sequences. For example, SEQ ID NO:xxx sets forth a particular sequence of DEFB 1 and SEQ ID NO:xxx sets forth a particular sequence of PAX2. Specifically disclosed are variants of these and other proteins herein disclosed which have at least, 70% or 75% or 80% or 85% or 90% or 95% homology to the stated sequence. Those of skill in the art readily understand how to determine the homology of two proteins. For example, the homology can be calculated after aligning the two sequences so that the homology is at its highest level.
Another way of calculating homology can be performed by published algorithms.
Optimal alignment of sequences for comparison may be conducted by the local homology algorithm of Smith and Waterman Adv. Appl. Math. 2: 482 (1981), by the homology alignment algorithm of Needleman and Wunsch, J. MoL Biol. 48: 443 (1970), by the search for similarity method of Pearson and Lipman, Proc. Natl. Acad. Sci. U.S.A. 85:
(1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by inspection.
The same types of homology can be obtained for nucleic acids by for example the algorithms disclosed in Zuker, M. Scierzce 244:48-52, 1989, Jaeger et al.
Proc. Natl. Acad.
Sci. USA 86:7706-7710, 1989, Jaeger et al.lVlethods Enzymol. 183:281-306, 1989 which are herein incorporated by reference for at least material related to nucleic acid alignment.
It is understood that the description of conservative mutations and homology can be combined together in any combination, such as embodiments that have at least 70%
homology to a particular sequence wherein the variants are conservative mutations.
As this specification discusses various proteins and protein sequences it is understood that the nucleic acids that can encode those protein sequences are also disclosed.
This would include all degenerate sequences related to a specific protein sequence, i.e. all nucleic acids having a sequence that encodes one particular protein sequence as well as all nucleic acids, including degenerate nucleic acids, encoding the disclosed variants and derivatives pf the protein sequences. Thus, while each particular nucleic acid sequence may not be written out herein, it is understood that each and every sequence is in fact disclosed and described herein through the disclosed protein sequence. For example, one of the many nucleic acid sequences that can encode the DEFB 1 protein sequence set forth in SEQ ID
NO:xxx is set forth in SEQ ID NO:xxx. It is also understood that while no amino acid -sequence indicates what particular DNA sequence encodes that protein within an organism, where particular variants of a disclosed protein are disclosed herein, the known nucleic acid sequence that encodes that protein in the particular DEFB 1 from which that protein arises is also known and herein disclosed and described.
It is understood that there are numerous arnino acid and peptide analogs which can be incorporated into the disclosed compositions. For example, there are numerous D amino acids or amino acids which have a different functional substituent then the amino acids shown in Table 1 and Table 2. The opposite stereo isomers of naturally occurring peptides are disclosed, as well as the stereo isomers of peptide analogs. These amino acids can readily be incorporated into polypeptide chains by charging tRNA molecules with the amino acid of choice and engineering genetic constructs that utilize, for example, amber codons, to insert the analog amino acid into a peptide chain in a site specific way (Thorson et al., Methods in Molec. Biol. 77:43-73 (1991), Zoller, Current Opinion in Biotechnology, 3:348-354 (1992); Ibba, Biotechnology & Genetic Enginerring Reviews 13:197-216 (1995), Cahill et al., TIBS, 14(10):400-403 (1989); Benner, TIB Tech, 12:158-163 (1994); Ibba and Hennecke, Bio/technology, 12:678-682 (1994) all of which are herein incorporated by reference at least for material related to amino acid analogs).
Molecules can be produced that resemble peptides, but which are not connected via a natural peptide linkage. For example, linkages for amino acids or amino acid analogs can include CH2NH--, --CH2S--, --CH2--CH2 --, --CH=CH-- (cis and trans), --COCH2 --, --CH(OH)CH2--, and --CHH2SO-(These and others can be found in Spatola, A. F. in Chemistry and Biochemistry of Amino Acids, Peptides, and Proteins, B.
Weinstein, eds., Marcel Dekker, New York, p. 267 (1983); Spatola, A. F., Vega Data (March 1983), Vol. 1, Issue 3, Peptide Backbone Modifications (general review); Morley, Trends Pharm Sci (1980) pp. 463-468; Hudson, D. et al., Int J Pept Prot Res 14:177-185 (1979) (--CH2NH--, CH2CH2--); Spatola et al. Life Sci 38:1243-1249 (1986) (--CH H2_--S); Hann J.
Chem. Soc Perkin Trans. I 307-314 (1982) (--CH--CH--, cis and trans); Almquist et al. J.
Med. Chem.
23:1392-1398 (1980) (--COCH2--); Jennings-White et al. Tetrahedron Lett 23:2533 (1982) (--COCH2--); Szelke et al. European Appin, EP 45665 CA (1982): 97:39405 (1982) (--CH(OH)CH2--); Holladay et al. Tetrahedron. Lett 24:4401-4404 (1983) (--C(OH)CHz--);
and Hruby Life Sci 31:189-199 (1982) (--CH2--S--); each of which is incorporated herein by reference. A particularly preferred non-peptide linkage is --CH2NH--. It is understood that peptide analogs can have more than one atom between the bond atoms, such as b-alanine, g-aminobutyric acid, and the like.
Amino acid analogs and analogs and peptide analogs often have enhanced or desirable properties, such as, more economical production, greater chemical stability, enhanced pharmacological properties (half-life, absorption, potency, efficacy, etc.), altered specificity (e.g., a broad-spectrum of biological activities), reduced antigenicity, and others.
D-amino acids can be used to generate more stable peptides, because D amino acids are not recognized by peptidases and such. Systematic substitution of one or more amino acids of a consensus sequence with a D-amino acid of the same type (e.g., D-lysine in place of L-lysine) can be used to generate more stable peptides. Cysteine residues can be used to cyclize or attach two or more peptides together. This can be beneficial to constrain peptides into particular conformations. (Rizo and Gierasch Ann. Rev. Biochem. 61:387 (1992), incorporated herein by reference).
Pharmaceutical carriers/Delivery of pharmaceutical products As described above, the compositions can also be administered in vivo in a pharmaceutically acceptable carrier. By "pharmaceutically acceptable" is meant a material that is not biologically or otherwise undesirable, i.e., the material may be administered to a subject, along with the nucleic acid or vector, without causing any undesirable biological effects or interacting in a deleterious manner with any of the other components of the pharmaceutical composition in which it is contained. The carrier would naturally be selected to minimize any degradation of the active ingredient and to minimize any adverse side effects in the subject, as would be well known to one of skill in the art.
The compositions may be administered orally, parenterally (e.g., intravenously), by intramuscular injection, by intraperitoneal injection, transdennally, extracorporeally, topically or the like, including topical intranasal administration or administration by inhalant. As used herein, "topical intranasal administration" means delivery of the compositions into the nose and nasal passages through one or both of the nares and can comprise delivery by a spraying mechanism or droplet mechanism, or through aerosolization of the nucleic acid or vector. Administration of the compositions by inhalant can be through the nose or mouth via delivery by a spraying or droplet mechanism.
Delivery can also be directly to any area of the respiratory system (e.g., lungs) via intubation. The exact amount of the compositions required will vary from subject to subject, depending on the species, age, weight and general condition of the subject, the severity of the allergic disorder being treated, the particular nucleic acid or vector used, its mode of administration and the like. Thus, it is not possible to specify an exact amount for every composition. However, an appropriate amount can be determined by one of ordinary skill in the art using only routine experimentation given the teachings herein.
Parenteral administration of the composition, if used, is generally characterized by injection. Injectables can be prepared in conventional forms, either as liquid solutions or suspensions, solid forms suitable for solution of suspension in liquid prior to injection, or as emulsions. A more recently revised approach for parenteral administration involves use of a slow release or sustained release system such that a constant dosage is maintained. See, e.g., U.S. Patent No. 3,610,795, which is incorporated by reference herein.
The materials may be in solution, suspension (for example, incorporated into microparticles, liposomes, or cells). These may be targeted to a particular cell type via antibodies, receptors, or receptor ligands. The following references are examples of the use of this technology to target specific proteins to tumor tissue (Senter, et al., Bioconiugate Chem., 2:447-451, (1991); Bagshawe, K.D., Br. J. Cancer, 60:275-281, (1989);
Bagshawe, et al., Br. J. Cancer, 58:700-703, (1988); Senter, et al., Bioconjugate Chem., 4:3-9, (1993);
Battelli, et al., Cancer Immunol. hnmunother., 35:421-425, (1992); Pietersz and McKenzie, hivmunolog. Reviews, 129:57-80, (1992); and Roffler, et al., Biochem.
Pharmacol, 42:2062-2065, (1991)). Vehicles such as "stealth" and other antibody conjugated liposomes (including lipid mediated drug targeting to colonic carcinoma), receptor mediated targeting of DNA through cell specific ligands, lymphocyte directed tumor targeting, and highly specific therapeutic retroviral targeting of murine glioma cells in vivo. The following references are examples of the use of this technology to target specific proteins to tumor tissue (Hughes et al., Cancer Research, 49:6214-6220, (1989); and Litzinger and Huang, Biochimica et Biophysica Acta, 1104:179-187, (1992)). In general, receptors are involved in pathways of endocytosis, either constitutive or ligand induced. These receptors cluster in clathrin-coated pits, enter the cell via clathrin-coated vesicles, pass through an acidified endosoine in which the receptors are sorted, and then either recycle to the cell surface, become stored intracellularly, or are degraded in lysosomes. The internalization pathways serve a variety of functions, such as nutrient uptake, removal of activated proteins, clearance of macromolecules, opportunistic entry of viruses and toxins, dissociation and degradation of ligand, and receptor-level regulation. Many receptors follow more than one intracellular pathway, depending on the cell type, receptor concentration, type of ligand, ligand valency, and ligand concentration. Molecular and cellular mechanisms of receptor-mediated endocytosis has been reviewed (Brown and Greene, DNA and Cell Biology 10:6, 399-409 (1991)).
-Pharmaceutically Acceptable Carriers The compositions, including DEFB1, DEFB1-encoding nucleic acids, oligonucleotide inhibitors of PAX2 binding, can be used therapeutically in combination with a pharmaceutically acceptable carrier.
Suitable carriers and their formulations are described in Remington: The Science and Practice of Phanmacy (19th ed.) ed. A.R. Gennaro, Mack Publishing Company, Easton, PA
1995. Typically, an appropriate amount of a pharmaceutically-acceptable salt is used in the formulation to render the formulation isotonic. Examples of the pharmaceutically-acceptable carrier include, but are not limited to, saline, Ringer's solution and dextrose solution. The pH of the solution is preferably from about 5 to about 8, and more preferably from about 7 to about 7.5. Further carriers include sustained release preparations such as semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g., films, liposomes or microparticles. It will be apparent to those persons skilled in the art that certain carriers may be more preferable depending upon, for instance, the route of administration and concentration of composition being administered.
Pharmaceutical carriers are known to those skilled in the art. These most typically would be standard carriers for administration of drugs to humans, including solutions such as sterile water, saline, and buffered solutions at physiological pH. The compositions can be administered intramuscularly or subcutaneously. Other compounds will be administered according to standard procedures used by those skilled in the art.
Pharmaceutical compositions may include carriers, thickeners, diluents, buffers, preservatives; surface active agents and the like in addition to the molecule of choice.
Pharmaceutical compositions may also include one or more active ingredients such as antimicrobial agents, antiinflammatory agents, anesthetics, and the like.
The pharmaceutical composition may be administered in a number of ways depending on whether local or systemic treatment is desired, and on the area to be treated. Administration may be topically (including ophthalmically, vaginally, rectally, intranasally), orally, by inhalation, or parenterally, for example by intravenous drip, subcutaneous, intraperitoneal or intramuscular injection. The disclosed antibodies can be administered intravenously, intraperitoneally, intramuscularly, subcutaneously, intracavity, or transdermally.
Preparations for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate. Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media. Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils. Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers (such as those based on Ringer's dextrose), and the like.
Preservatives and other additives may also be present such as, for example, antimicrobials, anti-oxidants, chelating agents, and inert gases and the like.
Formulations for topical administration may include ointments, lotions, creams, gels, drops, suppositories, sprays, liquids and powders. Conventional pharmaceutical carriers, aqueous, powder or oily bases, thickeners and the like may be necessary or desirable.
Compositions for oral administration include powders or granules, suspensions or solutions in water or non-aqueous media, capsules, sachets, or tablets.
Thickeners, flavorings, diluents, emulsifiers, dispersing aids or binders may be desirable..
Some of the compositions may potentially be administered as a pharmaceutically acceptable acid- or base- addition salt, formed by reaction with inorganic acids such as hydrochloric acid, hydrobromic acid, perchloric acid, nitric acid, thiocyanic acid, sulfuric acid, and phosphoric acid, and organic acids such as formic acid, acetic acid, propionic acid, glycolic acid, lactic acid, pyruvic acid, oxalic acid, malonic acid, succinic acid, maleic acid, and fumaric acid, or by reaction with an inorganic base such as sodium hydroxide, amm.onium hydroxide, potassium hydroxide, and organic bases such as mono-, di-, trialkyl and aryl amines and substituted ethanolamines.
Therapeutic Uses Effective dosages and schedules for administering the compositions may be determined empirically, and making such determinations is within the skill in the art.' The dosage ranges for the administration of the compositions are those large enough to produce the desired effect in which the symptoms disorder are effected. The dosage should not be so large as to cause adverse side effects, such as unwanted cross-reactions, anaphylactic reactions, and the like. Generally, the dosage will vary with the age, condition, sex and extent of the disease in the patient, route of administration, or whether other drugs are included in the regimen, and can be determined by one of skill in the art. The dosage can be adjusted by, the individual physician in the event of any counterindications.
Dosage can vary, and can be administered in one or more dose administrations daily, for one or several days. Guidance can be found in the literature for appropriate dosages for given classes of pharmaceutical products. For example, guidance in selecting appropriate doses for antibodies can be found in the literature on therapeutic uses of antibodies, e.g., Handbook of Monoclonal Antibodies, Ferrone et al., eds., Noges Publications, Park Ridge, N.J., (1985) ch. 22 and pp. 303-357; Smith et al., Antibodies in Human Diagnosis and Therapy, Haber et al., eds., Raven Press, New York (1977) pp. 365-389. A typical daily dosage of the oligonucleotide used alone might range from about 1 gg/kg to up to 100 mg/kg of body weight or more per day, depending on the factors mentioned above. In a more specific example, 5 to 7 mg/kg/day can be used. This is appropriate for i.v.
administration and higher dosages, up to about 150mg/m2/day s.c. are appropriate. This can be administered daily for a week in from 1 to 24 courses. See for example A Phase I
Pharmacokinetic and Biological Correlative Study of Oblimersen Sodium (Genasense, G3139), an Antisense Oligonucleotide to the Bcl-2 mRNA, and of Docetaxel in Patients with Hormone-Refractory Prostate Cancer, Clinical Cancer Research, Vol. 10, 5048-5057, August 1, 2004, incorporated herein for it's teaching of dosages for oligonucleotides.
Following administration of a disclosed composition for treating cancer, the efficacy of the therapeutic composition can be assessed in various ways well known to the skilled practitioner. For instance, one of ordinary skill in the art will understand that a composition, DEFB 1, DEFB 1-encoding nucleic acid, inhibitor of PAX2, disclosed herein is efficacious in treating cancer in a subject by observing that the composition reduces tumor load or prevents a fu.rther increase in tumor load. Methods of assessing tumor load are known in the art The compositions that inhibit the interactions between PAX2 and the DEFB 1 promoter can be administered prophylactically to patients or subjects who are at risk for cancer.
Other molecules that interact with PAX2 to inhibit its interaction with the promoter can be delivered in ways similar to those described for the pharmaceutical products.
The disclosed compositions and methods cain also be used for example as tools to isolate and test new drug candidates for a variety of related diseases. Thus, a method of identifying inhibitors of the binding of PAX2 to the DEFB 1 promoter is provided. The method can comprise contacting a system that expresses DEFB 1 with a putative inhibitor in the presence and/or absence of PAX2 to determine whether there is an inhibitory effect on this interaction.
Compositions identified by screening with disclosed compositions /
combinatorial chemistry Combinatorial chemistry The disclosed compositions can be used as targets for any combinatorial technique to identify molecules or macromolecular molecules that interact with the disclosed compositions in a desired way. Also disclosed are the compositions that are identified through combinatorial techniques or screening teclmiques in which the compositions disclosed as the PAX2 sequence or portions thereof (e.g., PAX2 DNA-binding domain), are used as the target in a combinatorial or screening protocol.
It is understood that when using the disclosed compositions in combinatorial techniques or screening methods, molecules, such as macromolecular molecules, will be identified that have particular desired properties such as inhibition or stimulation or the target molecule's fianction. The molecules identified and isolated when using the disclosed compositions, such as, DEFB1 or PAX2, are also disclosed. Thus, the products produced using the combinatorial or screening approaches that involve the disclosed compositions are also considered herein disclosed.
It is understood that the disclosed methods for identifying molecules that inhibit the interactions between, for example, DEFB1 promoter and.PAX2 can be performed using high through put means. For example, putative inhibitors can be. identified using Fluorescence Resonance Energy Transfer (FRET) to quickly identify interactions. The underlying theory of the techniques is that when two molecules are close in space, ie, interacting at a level beyond background, a signal is produced or a signal can be quenched.
Then, a variety of experiments can be performed, including, for example, adding in a putative inhibitor. If the inhibitor competes with the interaction between the two signaling molecules, the signals will be removed from each other in space, and this will cause a decrease or an increase in the signal, depending on the type of signal used.
This decrease or increasing signal can be correlated to the presence or absence of the putative inhibitor. Any signaling means can be used. For example, disclosed are methods of identifying an inhibitor of the interaction between any two of the disclosed molecules comprising, contacting a first molecule and a second molecule together in the presence of a putative inhibitor, wherein the first molecule or second molecule comprises a fluorescence donor, wherein the first or second molecule, typically the molecule not comprising the donor, comprises a fluorescence acceptor; and measuring Fluorescence Resonance Energy Transfer (FRET), in the presence of the putative inhibitor and the in absence of the putative inhibitor, wherein a decrease in FRET in the presence of the putative inhibitor as compared to FRET
measurement in its absence indicates the putative inhibitor inhibits binding between the two molecules. This type of inethod can be performed with a cell system as well.
Combinatorial chemistry includes but is not limited to all methods for isolating small molecules or macromolecules that are capable of binding either a small molecule or another macromolecule, typically in an iterative process. Proteins, oligonucleotides, and sugars are examples of macromolecules. For example, oligonucleotide molecules with a given function, catalytic or ligand-binding, can be isolated from a complex mixture of random oligonucleotides in what has been referred to as "in vitro genetics"
(Szostak, TIBS
19:89, 1992). One synthesizes a large pool of molecules bearing random and defined sequences and subjects that complex mixture, for example, approximately 1015 individual sequences in 100 g of a 100 nucleotide RNA, to some selection and enrichment process.
Through repeated cycles of affinity chromatography and PCR amplification of the molecules bound to the ligand on the column, Ellington and Szostak (1990) estimated that 1 in 1010 RNA molecules folded in such a way as to bind a small molecule dyes.
DNA
molecules with such ligand-binding behavior have been isolated as well (Ellington and Szostak, 1992; Bock et al, 1992). Techniques aimed at similar goals exist for small organic molecules, proteins, antibodies and other macromolecules known to those of skill in the art.
Screening sets of molecules for a desired activity whether based on small organic libraries, oligonucleotides, or antibodies is broadly referred to as combinatorial chemistry.
Combinatorial techniques are particularly suited for defining binding interactions between molecules and for isolating molecules that have a specific binding activity, often called aptamers when the macromolecules are nucleic acids.
There are a number of methods for isolating proteins which either have de novo activity or a modified activity. For example, phage display libraries have been used to isolate numerous peptides that interact with a specific target. (See for example, United States Patent No. 6,031,071; 5,824,520; 5,596,079; and 5,565,332 which are herein incorporated by reference at least for their material related to phage display and methods relate to combinatorial chemistry) A preferred method for isolating proteins that have a given function is described by Roberts and Szostak (Roberts R.W. and Szostak J.W. Proc. Natl. Acad. Sci. USA, 94(23)12997-302 (1997). This combinatorial chemistry method couples the functional power of proteins and the genetic power of nucleic acids. An RNA molecule is generated in which a puromycin molecule is covalently attached to the 3'-end of the RNA
molecule. An in vitro translation of this modified RNA molecule causes the correct protein, encoded by the RNA to be translated. In addition, because of the attachment of the puromycin, a peptdyl acceptor which cannot be extended, the growing peptide chain is attached to the puromycin which is attached to the RNA. Thus, the protein molecule is attached to the genetic material that encodes it. Normal in vitro selection procedures can now be done to isolate functional peptides. Once the selection procedure for peptide function is complete traditional nucleic acid manipulation procedures are performed to amplify the nucleic acid that codes for the selected functional peptides. After amplification of the genetic material, new RNA is transcribed with puromycin at the 3'-end, new peptide is translated and another functional round of selection is performed. Thus, protein selection can be performed in an iterative manner just like nucleic acid selection techniques. The peptide which is translated is controlled by the sequence of the RNA attached to the puromycin. This sequence can be anything from a random sequence engineered for optimum translation (i.e. no stop codons etc.) or it can be a degenerate sequence of a known RNA molecule to look for improved or altered function of a known peptide. The conditions for nucleic acid amplification and in vitro translation are well known to those of ordinary skill in the art and are preferably performed as in Roberts and Szostak (Roberts R.W. and Szostak J.W. Proc. Natl.
Acad. Sci.
USA, 94(23)12997-302 (1997)).
Another preferred method for combinatorial methods designed to isolate peptides is described in Cohen et al. (Cohen B.A.,et al., Proc. Natl. Acad. Sci. USA
95(24):14272-7' (1998)). This method utilizes and modifies two-hybrid technology. Yeast two-hybrid systems are useful for the detection and analysis of protein:protein interactions. The two-hybrid system, initially described in the yeast Saccharomyces cerevisiae, is a powerful molecular genetic technique for identifying new regulatory molecules, specific to the protein of interest (Fields and Song, Nature 340:245-6 (1989)). Cohen et al., modified this technology so that novel interactions between synthetic or engineered peptide sequences could be identified which bind a molecule of choice. The benefit of this type of technology is that the selection is done in an intracellular environment. The method utilizes a library of peptide molecules that attached to an acidic activation domain.
Using methodology well known to those of skill in the art, in combination with various combinatorial libraries, one can isolate and characterize those small molecules or macromolecules, which bind to or interact with the desired target. The relative binding affinity of these compounds can be compared and optimum compounds identified using competitive binding studies, which are well known to those of skill in the art.
Techniques for making combinatorial libraries and screening combinatorial libraries to isolate molecules which bind a desired target are well known to those of skill in the art.
Representative techniques and methods can be found in but are not limited to United States patents 5,084,824, 5,288,514, 5,449,754, 5,506,337, 5,539,083, 5,545,568, 5,556,762, 5,565,324, 5,565,332, 5,573,905, 5,618,825, 5,619,680, 5,627,210, 5,646,285, 5,663,046, 5,670,326, 5,677,195, 5,683,899, 5,688,696, 5,688,997, 5,698,685, 5,712,146, 5,721,099, 5,723,598, 5,741,713, 5,792,431, 5,807,683, 5,807,754, 5,821,130, 5,831,014, 5,834,195, 5,834,318, 5,834,588, 5,840,500, 5,847,150, 5,856,107, 5,856,496, 5,859,190, 5,864,010, 5,874,443, 5,877,214, 5,880,972, 5,886,126, 5,886,127, 5,891,737, 5,916,899, 5,919,955, 5,925,527, 5,939,268, 5,942,387, 5,945,070, 5,948,696, 5,958,702, 5,958,792, 5,962,337, 5,965,719, 5,972,719, 5,976,894, 5,980,704, 5,985,356, 5,999,086, 6,001,579, 6,004,617, 6,008,321, 6,017,768, 6,025,371, 6,030,917, 6,040,193, 6,045,671, 6,045,755, 6,060,596, and 6,061,636.
Combinatorial libraries can be made from a wide array of molecules using a number of different synthetic techniques. For example, libraries containing fused 2,4-pyrimidinediones (United States patent 6,025,371) dihydrobenzopyrans (United States Patent 6,017,768and 5,821,130), amide alcohols (United States Patent 5,976,894), hydroxy-amino acid amides (United States Patent 5,972,719) carbohydrates (United States patent 5,965,719), 1,4-benzodiazepin-2,5-diones (United States patent 5,962,337), cyclics (United States patent 5,958,792), biaryl amino acid amides (United States patent 5,948,696), thiophenes (United States patent 5,942,387), tricyclic Tetrahydroquinolines (United States patent 5,925,527), benzofurans (United States patent 5,919,955), isoquinolines (United States patent 5,916,899), hydantoin and thiohydantoin (United States patent 5,859,190), indoles (United States patent 5,856,496), imidazol-pyrido-indole and imidazol-pyrido-benzothiophenes (United States patent 5,856,107) substituted 2-methylene-2, 3-dihydrothiazoles (United States patent 5,847,150), quinolines (United States patent 5,840,500), PNA (United States patent 5,831,014), containing tags (United States patent 5,721,099), polyketides (United States patent 5,712,146), morpholino-subunits (United States patent 5,698,685 and 5,506,337), sulfamides (United States patent 5,618,825), and benzodiazepines (United States patent 5,288,514).
Screening molecules similar to the disclosed siRNA molecules for inhibition of PAX2 suppression of DEFB 1 expresson is a method of isolating desired compounds.
Molecules isolated which can either be competitive inhibitors or non-competitive inhibitors.
In another embodiment the inhibitors are non-competitive inhibitors. One type of non-competitive inhibitor will cause allosteric rearrangements.
As used herein combinatorial methods and libraries included traditional screening methods and libraries as well as methods and libraries used in iterative processes.
Computer assisted drug design The disclosed compositions can be used as targets for any molecular modeling technique to identify either the structure of the disclosed compositions or to identify potential or actual molecules, such as small molecules, which interact in a desired way with the disclosed compositions. The nucleic acids, peptides, and related molecules disclosed herein can be used as targets in any molecular modeling program or approach.
It is understood that when using the disclosed compositions in modeling techniques, molecules, such as macroniolecular molecules, will be identified that have particular desired properties such as inhibition or stimulation of the target molecule's function. The molecules identified and isolated when using the disclosed compositions, such as, SEQ ID
NO:1, are also disclosed. Thus, the products produced using the molecular modeling approaches that involve the disclosed compositions, such as, SEQ ID NO:1, are also considered herein disclosed.
Thus, one way to isolate molecules that bind a molecule of choice is through rational design. This is achieved through structural information and computer modeling.
Computer modeling technology allows visualization of the three-dimensional atomic structure of a selected molecule and the rational design of new compounds that will interact with the molecule. The three-dimensional construct typically depends on data from x-ray crystallographic analyses or NMR imaging of the selected molecule. The molecular dynamics require force field data. The computer graphics systems enable prediction of how a new compound will link to the target molecule and allow experimental manipulation of the structures of the compound and target molecule to perfect binding specificity.
Prediction of what the molecule-compound interaction will be when small changes are made in one or both requires molecular mechanics software and computationally intensive computers, usually coupled with user-friendly, menu-driven interfaces between the molecular design program and the user.
Examples of molecular modeling systems are the CHARMm and QUANTA
programs, Polygen Corporation, Waltham, MA. CHARMm performs the energy minimization and molecular dynamics functions. QUANTA performs the construction, graphic modeling and analysis of molecular structure. QUANTA allows interactive construction, modification, visualization, and analysis of the behavior of molecules with each other.
A number of articles review computer modeling of drugs interactive with specific proteins, such as Rotivinen, et al., 1988 Acta Pharmaceutica Fennica 97, 159-166; Ripka, New Scientist 54-57 (June 16, 1988); McKinaly and Rossmann, 1989 Annu. Rev.
PharmacoL. Toxiciol. 29, 111-122; Perry and Davies, 4SAR: Quantitative Structure-Activity Relationships in DrugDesign pp. 189-193 (Alan R. Liss, Inc. 1989);
Lewis and Dean, 1989 Proc. R. Soc. Lond. 236, 125-140 and 141-162; and, with respect to a model enzyme for nucleic acid components, Askew, et al., 1989 J. Am. Chem. Soc. 111, 1090. Other computer programs that screen and graphically depict chemicals are available from companies such as BioDesign, Inc., Pasadena, CA., Allelix, Inc, Mississauga, Ontario, Canada, and Hypercube, Inc., Cambridge, Ontario. Although these are primarily designed for application to drugs specific to particular proteins, they can be adapted to design of molecules specifically interacting with specific regions of DNA or RNA, once that region is identified.
Although described above with reference to design and generation of compounds which could alter binding, one could also screen libraries of known compounds, including natural products or synthetic chemicals, and biologically active materials, including proteins, for compounds which alter substrate binding or enzymatic activity.
Computer readable mediums It is understood that the disclosed nucleic acids and proteins can be represented as a sequence consisting of the nucleotides of amino acids. There are a variety of ways to display these sequences, for example the nucleotide guanosine can be represented by G or g.
Likewise the amino acid valine can be represented by Val or V. Those of skill in the art understand how to display and express any nucleic acid or protein sequence in any of the variety of ways that exist, each of which is considered herein disclosed.
Specifically contemplated herein is the display of these sequences on computer readable mediums, such as, commercially available floppy disks, tapes, chips, hard drives, compact disks, and video disks, or other computer readable mediums. Also disclosed are the binary code representations of the disclosed sequences. Those of skill in the art understand what computer readable mediums. Thus, computer readable mediums on which the nucleic acids or protein sequences are recorded, stored, or saved.
Disclosed are computer readable mediums comprising the sequences and information regarding the sequences set forth herein. Also disclosed are computer readable mediums comprising the sequences and information regarding the sequences set forth.
The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how the compounds, compositions, articles, devices and/or methods claimed herein are made and evaluated, and are intended to be purely exemplary and are not intended to limit the disclosure. Efforts have been made to ensure accuracy with respect to numbers (e.g., amounts, temperature, etc.), but some errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, temperature is in C or is at ambient temperature, and pressure is at or near atmospheric.
The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how the compounds, compositions, articles, devices and/or methods claimed herein are made and evaluated, and are intended to be purely exemplary of the invention and are not intended to limit the scope of what the inventors regard as their invention. Efforts have been made to ensure accuracy with respect to numbers (e.g., amounts, temperature, etc.), but some errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, temperature is in C or is at ambient temperature, and pressure is at or near atmospheric.
Example I
Human Beta Defensin-1 is Cytotoxic to Late-Stage Prostate Cancer and Plays a Role in Prostate Cancer Tumor Immunity Abstract DEFB 1 was cloned into an inducible expression system to examine what effect it had on normal prostate epithelial cells, as well as androgen receptor positive (AR~) and androgen receptor negative (AR") prostate cancer cell lines. Induction of DEFB
1 expression resulted in a decrease in cellular growth in AK cells DU145 and PC3, but had no effect on the growth of the AR+ prostate cancer cells LNCaP. DEFBl also caused rapid induction of caspase-mediated apoptosis. Data presented here are the first to provide evidence of its role in innate tumor immunity and indicate that its loss contributes to tumor progression in prostate cancer.
Materials and Methods Cell Lines The cell lines DU145 were cultured in DMEM medium, PC3 were grown in F12 medium, and LNCaP were grown in RPMI medium (Life Technologies, Inc., Grand Island, NY). Growth media for all three lines was supplemented with 10% (v/v) fetal bovine serum (Life Technologies). The hPrEC cells were cultured in prostate epithelium basal media (Cambrex Bio Science, Inc., Walkersville, MD). All cell lines were maintained at 37 C and 5% CO2.
Tissue Samples and Laser Capture Microdissection Prostate tissues obtained from consented patients that underwent radical prostatectomy were acquired through the Hollings Cancer Center tumor bank in accordance with an Institutional Review Board-approved protocol. This included guidelines for the processing, sectioning, histological characterization, RNA purification and PCR
amplification of samples. Following, pathologic examination of frozen tissue sections, laser capture microdissection (LCM) was performed to ensure that the tissue samples assayed consisted of pure populations of benign prostate cells. For each tissue section analyzed, LCM was performed at three different regions containing benign tissue and the cells collected were then pooled.
Cloning ofDEFBl Gene DEFB1 cDNA was generated from RNA by reverse transcription-PCR. The PCR
primers were designed to contain Clal and Kpnl restriction sites. DEFB 1 PCR
products were restriction digested with Clal and KpnI and ligated into a TA cloning vector. The TA/DEFB 1 vector was then transfected into E. coli by heat shock and individual clones were selected and expanded. Plasmids were isolated by Cell Culture DNA
Midiprep (Qiagen, Valencia, CA) and sequence integrity verified by automated sequencing. The DEFB 1 gene fragment was then ligated into the pTRE2 digested with Clal and Kpnl, which served as an intermediate vector for orientation purposes. Then the pTRE2/DEFB
construct was digested with Apal and KpnI to excise the DEFB 1 insert, which was ligated into pIND vector of the Ecdysone Inducible Expression System (Invitrogen, Carlsbad, CA) also double digested with Apal and Kpnl. The construct was again transfected into E. coli and individual clones were selected and expanded. Plasmids were isolated and sequence integrity of p1ND/DEFB 1 was again verified by automated sequencing.
Transfection Cells (1 x 106) were seeded onto 100-mm Petri dishes and grown overnight. Then the cells were co-transfected using Lipofectamine 2000 (Invitrogen, Carlsbad, CA) with 1 g of pVgRXR plasmid, which expresses the heterodimeric ecdysone receptor, and 1 g of the pIND/DEFB 1 vector construct or empty pIND control vector in Opti-MEM
media (Life Technologies, Inc., Grand Island, NY).
RNA Isolation and Quantitative RT-PCR
In order to verify DEFB 1 protein expression in the cells transfected with construct, RNA was collected after a 24 hour induction period with Ponasterone A (Pon A).
Briefly, total RNA was isolated using the SV Total RNA Isolation System (Promega, Madison, WI) from approximately 1X 106 cells harvested by trypsinizing. Here, cells were lysed and total RNA was isolated by centrifugation through spin columns. For cells collected by LCM, total RNA was isolated using the PicoPure RNA Isolation Kit (Arcturus Biosciences, Mt. View, CA) following the manufacturer's protocol. Total RNA
(0.5 g per reaction) from both sources was reverse transcribed into cDNA utilizing random primers (Promega). AMV Reverse Transcriptase II enzyme (500 units per reaction;
Promega) was used for first strand synthesis and Tfl DNA Polymerase for second strand synthesis (500 units per reaction; Promega) as per the manufacturer's protocol. In each case, 50 pg of cDNA was used per ensuing PCR reaction. Two-step QRT-PCR was performed on cDNA
generated using the MultiScribe Reverse Transcripatase from the TaqMan Reverse Transcription System and the SYBR Green PCR Master Mix (Applied Biosystems).
The primer pair for DEFB 1(Table 3) was generated from the published DEFB1 sequence (GenBank Accession No. U50930)10. Forty cycles of PCR were performed under standard conditions using an annealing temperature of 56 C. In addition, ,6-actin (Table 3) was amplified as a housekeeping gene to normalize the initial content of total cDNA.
DEFB 1 expression was calculated as the relative expression ratio between DEFB
1 and ,6-actin and was compared in cells lines induced and uninduced for DEFBl expression, as well as LCM benign prostatic tissue. As a negative control, QRT-PCR reactions without cDNA
template were also performed. All reactions were run three times in triplicate.
MTT Cell Viability Assay To examine the effects of DEFBI on cell growth, metabolic 3-[4,5-dimethylthiazol-2y1]-2,5 diphenyl tetrazolium bromide (MTT) assays were performed. PC3, DU145 and LNCaP cells co-transfected with pVgRXR plasmid and pIND/DEFB1 construct or empty pIND vector were seeded onto a 96-well plate at 1-5 x103 cells per well.
Twenty-four hours after seeding, fresh growth medium was added containing 10 M Ponasterone A
daily to induce DEFB 1 expression for 24-, 48- and 72 hours after which the MTT assay was performed according to the manufacturer's instructions (Promega). Reactions were performed three times in triplicate.
Flow Cytometry PC3 and DU145 cells co-transfected with the DEFB 1 expression system were grown in 60-mm dishes and induced for 12, 24, and 48 hours with 10 M Ponasterone A.
Following each incubation period, the medium was collected from the plates (to retain any detached cells) and combined with PBS used to wash the plates. The remaining attached cells were harvested by trypsinization and combined with the detached cells and PBS. The cells were then pelleted at 4 C (500 x g) for 5 min, washed twice in PBS, and resuspended in 100ul of lx Annexin binding buffer (0.1 M Hepes/NaOH at pH 7.4, 1.4 M NaCl, 25 mM
CaC12) containing 5[t1 of Annexin V-FITC and 5 gl of PI. The cells were incubated at RT
for 15 min in the dark, then diluted with 400 l of lx Annexin binding buffer and analyzed by FACscan (Becton Dickinson, San Jose, CA). All reactions were performed three times.
Microscopic Analysis Cell morphology was analyzed by phase contrast microscopy. DU145, PC3 and LNCaP cells containing no vector, empty plasmid or DEFB 1 plasmid were seeded onto 6 well culture plates (BD Falcon, USA). The following day plasmid-containing cells were induced for a period of 48h with media containing 10 M Ponasterone A, while control cells received fresh media. The cells were then viewed under an inverted Zeiss microscope (Carl Zeiss, Germany). Phase contrast pictures of a field of cells were obtained using the SPOT Insight Mosaic 4.2 camera (Diagnostic Instruments, USA). Cells were examined by phase contrast microscopy under 32X magnification and digital images were stored as uncompressed TIFF files and exported into Photoshop CS software (Adobe Systems, San Jose, CA) for image processing and hard copy presentation.
Caspase Detection Detection of caspase activity in the prostate cancer cell lines was performed using APO LOGIXTM Carboxyfluorescin Caspase detection kit (Cell Technology, Mountain View, CA). Active caspases were detected through the use of a FAM-VAD-FMK
inhibitor that irreversibly binds to active caspases. Briefly, DU145 and PC3 cells (1.5-3 X105) containing the DEFB 1 expression system were plated in 35 mm glass bottom microwell dishes (Matek, Ashland, MA) and treated for 24 hours with media only or with media containing PonA as previously described. Next, 10 l of a 30X working dilution of carboxyfluorescein labeled peptide fluoromethyl ketone (FAM-VAD-FMK) was added to 300 1 of media and added to each 35 mm dish. Cells were then incubated for 1 hour at 37 C under 5% CO2. Then, the medium was aspirated and the cells were washed twice with 2 ml of a 1X Working dilution Wash Buffer. Cells were viewed under differential interference contrast (DIC) or under laser excitation at 488nm. The fluorescent signal was analyzed using a confocal microscope (Zeiss LSM 5 Pascal) and a 63X DIC oil lens with a Vario 2 RGB Laser Scanning Module.
Statistical Analysis Statistical differences were evaluated using the Student's t-test for unpaired values.
P values were determined by a two-sided calculation, and a P value of less than 0.05 was considered statistically significant.
Results DEFBl Expression in Prostate Tissue and Cell Lines DEFB1 expression levels were measured by QRT-PCR in benign and malignant prostatic tissue, hPrEC prostate epithelial cells and DU145, PC3 and LNCaP
prostate cancer cells. DEFB1 expression was detected in all of the benign clinical samples.
The average amount of DEFB1 relative expression was 0.0073. In addition, DEFB1 relative expression in hPrEC cells was 0.0089. There was no statistical difference in DEFB1 expression detected in the benign prostatic tissue samples and hPrEC (Figure 1A).
Analysis of the relative DEFB 1 expression levels in the prostate cancer cell lines revealed significantly lower levels in DU145, PC3 and LNCaP. As a further point of reference, relative DEFB1 expression was measured in the adjacent malignant section of prostatic tissue from patient #1215. There were no significant differences in the level of DEFB1 expression observed in the three prostate cancer lines compared to malignant prostatic tissue from patient #1215 (Figure 1B). In addition, expression levels in all four samples were close to the no template negative controls which confirxned little to no endogenous DEFB 1 expression (data not shown). QRT-PCR was also performed on the prostate cancer cell lines transfected with the DEFB1 expression system. Following a 24 hour induction period, relative expression levels were 0.01360 in DU145, 0.01503 in PC3 and 0.138 in LNCaP. Amplification products were verified by gel electrophoresis.
QRT-PCR was performed on LCM tissues regions containing benign, PIN and cancer. DEFB 1 relative expression was 0.0146 in the benign region compared to 0.0009 in the malignant region (Figure 1 C.). This represents a 94% decrease which again demonstrates a significant down-regulation of expression. Furthermore, analysis of PIN
revealed that DEFB1 expression level was 0.044 which was a 70% decrease.
Conzparing expression in patient #1457 to the average expression level found in benign regions of six other patients (Figure 1 A.) revealed a ratio of 1.997 representing almost twice as much expression (Figure 1D.). However, the expression ratio was 0.0595 in PIN and was 0.125 in malignant tissue compared to average expression levels in benign tissue.
DEFB1 Causes Cell Membrane Permeability and Ruffling Induction of DEFB1 in the prostate cancer cell lines resulted in a significant reduction in cell number in DU145 and PC3, but had no effect on cell proliferation in LNCaP (Figure 2). As a negative control, cell proliferation was monitored in all three lines containing empty plasmid. There were no observable changes in cell morphology in DU145, PC3 or LNCaP cells following the addition of PonA. In addition, DEFB1 induction resulted in morphological changes in both DU145 and PC3. Here cells appeared more rounded and exhibited membrane ruffling indicative of cell death.
Apoptotic bodies were also present in both lines.
Expression of DEFBl Results in Decreased Cell Viability The MTT assay showed a reduction in cell viability by DEFBl in PC3 and DU145 cells, but no significant effect on LNCaP cells (Figure 3). After 24 hours, relative cell viability was 72% in DU145 and 56% in PC3. Analysis 48 hours after induction revealed 49% cell viability in DU145 and 37% cell viability in PC3. After 72 hours of DEFBl expression resulted in 44% and 29% relative cell viability in DU145 and PC3 cells, respectively.
DEFBl Causes Rapid Caspase-mediated Apoptosis in Late-stage Prostate Cancer Cells In order to determine whether the effects of DEFBl on PC3 and DU145 were cytostatic or cytotoxic, FACS analysis was performed. Under normal growth conditions, more than 90% of PC3 and DU145 cultures were viable and non-apoptotic (lower left quadrant) and did not stain with annexin V or PI (Figure 4). After inducing expression in PC3 cells, the number of apoptotic cells (lower and upper right quadrants) totaled 10% at 12 hours, 20% at 24 hours, and 44% at 48 hours. For DU145 cells, the number of apoptotic cells totaled 12% after 12 hours, 34% at 24 hours, and 59%
after 48 hours of induction. There was no-increase in apoptosis observed in cells containing empty plasmid following induction with PonA (data not shown).
Caspase activity was determined by confocal laser microscopic analysis (Figure 5).
DU145 and PC3 cell were induced for DEFB 1 expression and activity was monitored based on the binding of green fluoresing FAM-VAD-FMK to caspases in cells actively undergoing apoptosis. Analysis of cells under DIC showed the presence of viable control DU145 (A), PC3 (E) and LNCaP (1) cells at 0 hours. Excitation by the confocal laser at 488 nm produced no detectable green staining which indicates no caspase activity in DU145 (B), PC3 (F) or LNCaP (J). Following induction for 24 hours, DU145 (C), PC3 (G) and LNCaP (K) cells were again visible under DIC. Confocal analysis under fluorescence revealed green staining in DU145 (D) and PC3 (H) cell indicating caspase activity.
However, there was no green staining in LNCaP (L), indicating no induction of apoptosis by DEFB 1.
siRNA Silencing of PAX2 I In order to achieve efficient gene silencing, a pool of four complementary short interfering ribonucleotides (siRNAs) targeting human PAX2 mRNA (Accession No.
NM 003989.1), were synthesized (Dharmacon Research, Lafayette, CO, USA). A
second pool of four siRNAs were used as an internal control to test for the specificity of PAX2 siRNAs. Two of the sequences synthesized target the GL2 luciferase mRNA
(Accession No. X65324), and two were non-sequence-specific (Table 4). For annealing of siRNAs, 35 M of single strands were incubated in annealing buffer (100 mM potassium acetate, 30 mM
HEPES-KOH at pH 7.4, 2 mM magnesium acetate) for 1 min at 90 C followed by 1 h incubation at 37 C.
Western Analysis Briefly, cells were harvested by trypsinization and washed twice with PBS.
Lysis buffer was prepared according to the manufacturer's instructions (Sigma), and was then added to the cells. Following a 15 minute incubation period at 4 C on an orbital shaker, cell lysate were then collected and centrifuged for 10 minutes at 12000xg to pellet cellular debris. The protein-containing supernatant were then collected and quantitated. Next, 25 gg protein extract was loaded onto an 8-16% gradient SDS-PAGE (Novex).
Following electrophoresis, proteins were transferred to PVDF membranes, and then blocked with 5%
nonfat dry milk in TTBS (0.05% Tween 20 and 100mM Tris-Cl) for 1 hour. Blots were then probed with rabbit anti-Pax2 primary antibody (Zymed, San Francisco, CA) at a 1:2000 dilution. After washing, the membranes were incubated with anti-rabbit antibody conjugated to horseradish peroxidase (HRP) (dilution 1:5000; Sigma), and signal detection was visualized using chemilluminescence reagents (Pierce) on an Alpha Innotech Fluorchem 8900. As a control, blots were stripped and reprobed with mouse anti-,6-actin primary antibody (1:5000; Sigma-Aldrich) and HRP- conjugated anti-mouse secondary antibody (1:5000; Sigma-Aldrich) and signal detection was again visualized.
Plaase Contrast Microscopy The effect of PAX2 knock-down on cell growth was analyzed by phase contrast microscopy. Here, 1-2 xl04 cells were seeded onto 6 well culture plates (BD
Falcon, USA).
The following day cells were treated with media only, negative control non-specific siRNA
or PAX2 siRNA and allowed to incubate for six days. The cells were then viewed under an inverted Zeiss IM 35 microscope (Carl Zeiss, Germany) at 32x magnification.
Phase contrast pictures of a field of cells were obtained using the SPOT Insight Mosaic 4.2 camera (Diagnostic Instruments, USA).
MTT Cytotoxicity Assay DU145, PC3 and LNCaP cells (1x105) were transfected with 0.5gg of the PAX2 siRNA pool or control siRNA pool using Codebreaker transfection reagent according to the manufacturer's protocol (Promega). Next, cell suspensions were diluted and seeded onto a 96-well plate at 1-5 x103 cells per well and allowed to grow for 2-, 4- or 6 days. After culture, cell viability was determined by measuring the conversion of 3-[4,5-dimethylthiazol-2yl]-2,5 diphenyl tetrazolium bromide, MTT (Promega), to a colored formazan product. Absorbance was read at 540 nm on a scanning multiwell spectrophotometer.
Pan-Caspase Detection Detection of caspase activity in the prostate cancer cell lines was performed using APO LOGIXTM Carboxyfluorescin Caspase detection kit (Cell Technology, Mountain View, CA). Active caspases were detected through the use of a FAM-VAD-FMK
inhibitor that irreversibly binds to active caspases. Briefly, cells (1-2 X104) onto 35 mm glass bottom microwell dishes (Matek, Ashland, MA) and treated with media only or siRNA as previously described. Next, 10 l of a 30X working dilution of carboxyfluorescein labeled peptide fluoromethyl ketone (FAM-VAD-FMK) was added to 300g1 of media and added to each 35 mm dish. Cells were then incubated for 1 hour at 37 C under 5% CO2. Then, the medium was aspirated and the cells were washed twice with 2 ml of a 1X Working dilution Wash Buffer. Cells were viewed under differential interference contrast (DIC) or under laser excitation at 488nm. The fluorescent signal was analyzed using a confocal microscope (Zeiss LSM 5 Pascal) and a 63X DIC oil lens with a Vario 2 RGB Laser Scanning Module.
Quantitative Real-time RT-PCR
Quantitative real-time RT-PCR was performed in order to verify gene expression after PAX2 siRNA treatment in PC3, DU145 and LNCaP cell lines. Total RNA was isolated using the SV Total RNA Isolation System (Promega). Briefly, approximately 1 x 106 cells were harvested by trypsinizing, and rinsed in PBS. Cells were then lysed and total RNA was isolated by centrifugation through spin columns. Total RNA (0.5 g per reaction) was reverse transcribed into cDNA utilizing Oligo (dT) 15 primer (Promega) and AMV
Reverse Transcriptase II enzyme (500 units per reaction; Promega) for first strand synthesis and Tfl DNA Polymerase for for second strand synthesis (500 units per reaction; Promega) as per the manufacturers' protocol, with identical control samples treated without RT
enzyme. Typically, 50 pg of each cDNA was used per ensuing PCR reactionTwo-step QRT-PCR was performed on cDNA generated using the MultiScribe Reverse Transcripatase from the TaqMan Reverse Transcription System and the SYBR Green PCR Master Mix (PE
Biosystems). The primer pairs for BAX, BID and BAD were generated from the published sequences (Table3). Reactions were performed in MicroAmp Optical 96-well Reaction Plate (PE Biosystems). Forty cycles of PCR were performed under standard conditions using an annealing temperature of 60 C. Quantification was determined by the cycle nuinber where exponential amplification began (threshold value) and averaged from the values obtained from the triplicate repeats. There was an inverse relationship between message level and threshold value. In addition, GAPDH was used as a housekeeping gene to normalize the initial content of total cDNA. Gene expression was calculated as the relative expression ratio between the pro-apoptotic genes and GAPDH. All reactions were carried out in triplicate.
Results siRNA Inhibition of PAX2 Protein In order to confirm that the siRNA effective targeted the PAX2 mRNA, Western Analysis was performed to monitor PAX2 protein expression levels over a six day treatment period. Cells were given a single round of transfection with the pool of PAX2 siRNA. The results confirmed specific targeting of PAX2 mRNA by showing knock-down of protein by day four in DU145 (Figure 6a) and by day six in PC3 (Figure 6b).
Knock-down of PAX2 itahibit Prostate Cancer Cell Growtla Cells were analyzed following a six day treatment period with media only, negative control non-specific siRNA or PAX2 siRNA (Figure 7). DU145 (a), PC3 (d) and LNCaP
(g) cells all reached at least 90% confluency in the culture dishes containing media only.
Treatment of DU145 (b), PC3 (e) and LNCaP (h) with negative control non-specific siRNA
had no effect on cell growth, and cells again reached confluency after six days. However, treatment with PAX2 siRNA resulted in a significant decrease in cell number.
DU145 cells were approximately 15% confluent (c) and PC3 cells were only 10% confluent (f). LNCaP
cell were 5% confluent following siRNA treatment.
Cytotoxicity Assays Cell viability was measured after two-, four-, and six-day exposure times, and is expressed as a ratio of the 570-630 nm absorbance of treated cells divided by that of the untreated control cells (Figure 8). Relative cell viability following 2 days of treatment was 77% in LNCaP, 82% in DU145 and 78 % in PC3. After four days, relative cell viability was 46% in LNCaP, 53% in DU145 and 63% in PC3. After six days of treatment, relative cell viability decreased to 31% in LNCaP, 37% in PC3, and was 53% in DU145. As negative controls, cell viability was measured in after a six day treatment period with negative control non-specific siRNA or transfection reagent alone. For both conditions, there was no statistically significant change in cell viability compared to normal growth media (data not shown).
Pan-Caspase Detection Caspase activity was detected by confocal laser microscopic analysis. DU145, and LNCaP cells were treated with PAX2 siRNA and activity was monitored based on the binding of FAM-labeled peptide to caspases in cells actively undergoing apoptosis which will fluoresce green. Analysis of cells with media only under DIC shows the presence of viable DU145 (A), PC3 (E) and LNCaP (I) cells at 0 hours (Figure 9).
Excitation by the confocal laser at 488 nm produced no detectable green staining which indicates no caspase activity in untreated DU145 (B), PC3 (F) or LNCaP (J). Following four days of treatment with PAX2 siRNA, DU145 (C), PC3 (G) and LNCaP (K) cells were again visible under DIC. Under fluorescence, the treated DU145 (D), PC3 (H) and LNCaP (L) cells presented green staining indicating caspase activity.
Effect of Pax2 Inhibition on Pro-apoptotic Factors DU145, PC3 and LNCaP cells were treated with siRNA against PAX2 for six days and expression of pro-apoptotic genes dependent and independent of p53 transcription regulation were measured to monitor cell death pathways. For BAX, there was a 1.81-fold increase in LNCaP, a 2.73-fold increase in DU145, and a 1.87-fold increase in PC3 (Figure 10a). Expression levels of BID increased by 1.38-fold in LNCaP and 1.77-fold in DU145 (Figure lOb). However, BID expression levels decreased by 1.44-fold in PC3 following treatment (Figure lOc). Analysis of BAD revealed a 2.0-fold increase in expression in LNCaP, a 1.38-fold increase in DU145, and a 1.58-fold increase in PC3.
Conclusion Despite significant advances in cancer therapy there is still little progress in the treatment of advanced disease. Successful drug treatment of prostate cancer requires the use of therapeutics with specific effects on target cells while maintaining minimal clinical effects on the host. The goal of cancer therapy is to trigger tumor-selective cell death.
Therefore, understanding the mechanisms in such death is critical in determining the efficacy of a specific treatment.
The dependency of prostate cancer cell survival on PAX2 expression is shown here.
In order to distinguish between death observed in the p53-expressing cell line LNCaP, the p53-mutated line DU145, and the p53-null line PC3 downstream events that follow p53 activation as a result of PAX2 knock-down were examined. Caspase activity was detected in all three lines indicative of the initiation of programmed cell death. With this, changes in the expression of pro-apoptotic genes were examined. Here, BAX expression was upregulated in all three cell lines independent of p53 status. The expression of pro-apoptotic factor BAD was increased in all three lines following PAX2 inhibition.
Following treatment with PAX2 siRNA, BID expression was increased in LNCaP and DU145, but actually decreased in PC3. This indicates that cell death observed in prostate cancer is influenced by but is not dependent on p53 expression. The initiation of apoptosis in prostate cancer cells through different cell death pathways irrespective of p53 status indicates that PAX2 inhibits other tumor suppressors Example III
Inhibition of PAX2 Oncogene Results in DEFB1-Mediated Death of Prostate Cancer Cells Abstract The identification of tumor-specific molecules that serve as targets for the development of new cancer drugs is considered to be a major goal in cancer research.
Example I demonstrated that there is a high frequency of DEFBl expression loss in prostate cancer, and that induction of DEFB1 expression results in rapid apoptosis in androgen receptor negative-stage prostate cancer. These data show that DEFB 1 plays a role in prostate tumor suppression. In addition, given that it is a naturally occurring component of the immune system of normal prostate epithelium, DEFB1 is expected to be a viable therapeutic agent with little to no side effects. Example II demonstrated that inhibition of PAX2 expression results in prostate cancer cell death independent of p53.
These data indicate that there is an addition pro-apoptotic factor or tumor suppressor that is inhibited by PAX2. In addition, the data show that the oncogenic factor PAX2, which is over-expressed in prostate cancer, is a transcriptional repressor of DEFB1. The purpose of this study is to determine if DEFB 1 loss of expression is due to aberrant expression of the PAX2 oncogene, and whether inhibiting PAX2 results in DEFB 1-mediated cell death.
The data show that loss of DEFB1 expression occurs at the transcriptional level.
Furthermore, computational analysis of the DEFB1 promoter revealed the presence of a GTTCC DNA binding site for the PAX2 transcriptional repressor next to the DEFB
box (Figure 1). The results presented here show that PAX2 and DEFB1 exhibit several attributes of suitable cancer targets, including a role in the suppression of cell death.
Therefore, DEFB 1 plays a role in tumor immunity and its expression is modulated through therapeutic down-regulation of the PAX2 oncogene.
Materials and Methods RNA Isolation and Quantitative RT-PCR
In order to verify changes in DEFB1 expression levels RNA was collected after days of PAX2 siRNA treatment. Briefly, total RNA was isolated using the SV
Total RNA
Isolation System (Promega, Madison, WI) from approximately 1 x 106 cells harvested by trypsinizing. Here, cells were lysed and total RNA was isolated by centrifugation through spin columns. Total RNA (0.5 g per reaction) from both sources was reverse transcribed into cDNA utilizing random primers (Promega). AMV Reverse Transcriptase II
enzyme (500 units per reaction; Promega) was used for first strand synthesis and Tfl DNA
Polymerase for second strand synthesis (500 units per reaction; Promega) as per the manufacturer's protocol. In each case, 50 pg of cDNA was used per ensuing PCR
reaction.
Two-step QRT-PCR was performed on cDNA generated using the MultiScribe Reverse Transcripatase from the TaqMan Reverse Transcription System and the SYBR Green PCR
Master Mix (Applied Biosystems).
The primer pair for DEFB 1 was generated from the published DEFB1 sequence (Accession No. U50930). Forty cycles, of PCR were performed under standard conditions using an annealing temperature of 56 C. In addition, GAPDH was amplified as a housekeeping gene to normalize the initial content of total cDNA. DEFBl expression was calculated as the relative expression ratio between DEFB 1 and GAPDH and was compared in cells lines before and after siRNA knock-down of PAX2 expression. All reactions were run three times in triplicate.
Generation of the DEFBI Reporter Construct The pGL3 luciferase reporter plasmid was used to monitor DEFB1 reporter activity.
Here, a region 160 bases upstream of the DEFB1 transcription initiation site and included the DEFB1 TATA box. The region also included the GTTCC sequence which is necessary for PAX2 binding. The PCR primers were designed to contain Kpnl and Nhel restriction sites. The DEFB1 promoter PCR products were restriction digested Kpn I and NheI and ligated into a similary restriction digested pGL3 plasmid (Figure 2). The constructs were transfected into E. coli and individual clones were selected and expanded.
Plasmids were isolated and sequence integrity of the DEFB1/pGL3 construct was verified by automated sequencing.
Luciferase Reporter Assay Here, 1 g of the DEFBI reporter construct or the control pGL3 plasmid was transfected into 1x106 DU145 cells. Next, 0.5x103 cells were seeded onto each well of a 96-well plate and allowed to grow overnight. Then fresh medium was added containing PAX2 siRNA or media only and the cells were incubated for 48 hours. Luciferase was detected by the BrightGlo kit accourding to the manufacturer's protocol (Promega) and the plates were read on a Veritas automated 96-well luminometer. Promoter activity was expressed as relative luminescence.
Analysis of Membrane Permeability Acridine orange (AO)/ethidium bromide (EtBr) dual staining was performed to identify changes in cell membrane integrity, as well as apoptotic cells by staining the condensed chromatin. AO stains viable cells as well as early apoptotic ceHs, whereas EtBr stains late stage apoptotic cells that have lost membrane permeability.
Briefly, cells were seeded inta 2 chamber culture slides (BD Falcon, USA). Cells transfected with empty pIND plasmid/pvgRXR or pIND DEFB1/pvgRXR were induced for 24 or 48 h with media containing 10 M Ponasterone A. Control cells were provided fresh media at 24 and 48h.
In order to determine the effect of PAX2 inhibition on membrane integrity, separate culture slides containing DU145, PC3 and LNCaP were treated with PAX2 siRNA and incubated for 4 days. Following this, cells were washed once with PBS and stained with 2 ml of a mixture (1:1) of AO (Sigma, USA) and EtBr (Promega, USA) (5ug/ml) solution for 5 min.
Following staining, the cells were again washed with PBS. Fluorescence was viewed by a Zeiss LSM 5 Pascal Vario 2 Laser Scanning Confocal Microscope (Carl Zeiss Jena, Germany). The excitation color wheel contain BS505-530 (green) and LP560 (red) filter blocks which allowed for the separation of emitted green light from AO into the green channel and red light from EtBr into the red channel. The laser power output and gain control settings within each individual experiment were identical between control and DEFB1 induced cells. The excitation was provided by a Kr/Ar mixed gas laser at wavelengths of 543nm for AO and 488 nm for EtBr. Slides were analyzed under magnification and digital images were stored as uncompressed TIFF files and exported into Photoshop CS software (Adobe Systems, San Jose, CA) for image processing and hard copy presentation.
ChIP Analysis of PAX2 Chromatin immunoprecipitation (ChIP) allows the identification of binding sites for DNA-binding proteins based upon in vivo occupancy of a promoter by a transcription factor and enrichment of transcription factor bound chromatin by immunoprecipitation (66). A
modification of the protocol described by the Farnham laboratory ((67, 68) was used; also on line at http://mcardle.oncology.wisc.edu/farnham/). The DU145 and PC3 cell lines over-expresses the PAX2 protein, but does not express DEFB1. Cells were incubated with PBS
containing 1.0% formaldehyde for 10 minutes to crosslink proteins to DNA.
Samples were then sonicated to yield DNA with an average length of 600 bp. Sonicated chromatin precleared with Protein A Dynabeads was incubated with PAX2-specific antibody or "no antibody" control [isotype-matched control antibodies]. Washed immunoprecipitates were then collected. After reversal of the crosslinks, DNA was analyzed by PCR
using promoter-specific primers to determine whether DEFB1 is represented in the PAX2-immunoprecipitated. samples. Primers were designed to amplify the 160 bp region immediately upstream of the DEFB 1 mRNA start site which contained the DEFB 1 TATA
box and the functional GTTCC PAX2 recognition site. For these studies, positive controls included PCR of an aliquot of the input chromatin (prior to immunoprecipitation, but crosslinks reversed). All steps were perfonned in the presence of protease inhibitors.
Results siRNA Inhibition of PA.X2 Increases DEFB1 Expression QRT-PCR analysis of DEFB1 expression before siRNA treatment revealed relative expression levels of 0.00097 in DU145, 0.00001 in PC3, and .00004 LNCaP
(Figure 13).
Following siRNA knock-down of PAX2, relative expression was .03294 (338-fold increase) in DU145,.00020 (22.2-fold increase) in PC3 and 0.00019 (4.92-fold increase) in LNCaP.
As a negative control, the human prostate epithelial cell line (hPrEC) which is PAX2 null, revealed expression levels at 0.00687 before treatment and 0.00661 following siRNA
treatment confirming no statistical change in DEFB 1 expression.
DEFBI Causes Cell Membrane Permeability Membrane integrity was monitored by confocal analysis (Figure 14). Here, intact cells stain green due to AO which is membrane permeable. In addition, cells with compromised plasma membranes would stain red by EtBr which is membrane impermeable.
Here, uninduced DU145 (A) and PC3 (D) cells stained positively with AO and emitted green color, but did not stain with EtBr. However, DEFB1 induction in both DU145 (B) and PC3 (E) resulted in the accumulation of EtBr in the cytoplasm at 24 hours indicated by the red staining. By 48 hours, DU145 (C) and PC3 (F) possessed condensed nuclei and appeared yellow, which was due to the presence of both green and red staining resulting from the accumulation of AO and EtBr, respectively.
Inhibition of PAX2 Results in Membrane Pernaeability Cells were treated with PAX2 siRNA for 4 days and membrane integrity was monitored again by confocal analysis (Figure 15). Here, both DU145 (B) and PC3 (E) possessed condensed nuclei and appeared yellow. However, LNCaP cells' cytoplasm and nuclei remained green following siRNA treament. Also red staining at the cell periphery indicates the maintenance of cell membrane integrity. These findings indicate that the inhibition of PAX2 results in specifically DEFB 1 -mediated cell death in DU1145 and PC3, but not LNCaP cells. Death observed in LNCaP (refer to Chapter II) is due to the transactivation of the existing wild-type p53 in LNCap following PAX2 inhibition.
siRNA Inhibition of PAX2 Increases DEFB1 Promoter Activity Analysis of DEFB1 promoter activity in DU145 cells containing the DEFB1/pGL3 construct revealed a 2.65 fold increase in relative light units following 48 hours of treatment compared to untreated cells (Figure 16). In PC3 cells, there was a 3.78-fold increase in relative light units compared to untreated cells.
PAX2 Binds to the DEFBI Promoter ChIP analysis was performed on DU145 and PC3 cells to determine if the PAX2 transcriptional repressor is bound to the DEFB1 promoter (Figure 17). Lane 1 contains a 100 bp molecular weight marker. Lane 2 is a positive control representing 160 bp region of the DEFBl promoter amplified from DU145 before cross-linking and immunoprecipitation.
Lane 3 is a negative control representing PCR performed without DNA. Lane 4 and 5 are negative controls representing PCR from immunoprecipitations performed with IgG from cross-linked DU145 and PC3, respectively. PCR amplification of 25pg of DNA
(lane 6 and 8) and 50pg of DNA (lane 7 and 9) immunoprecitipated with anti-PAX2 antibody after crosslinking show 160 bp promoter fragment in DU145 and PC3, respectively.
Conclusion The present novel data are the first to disclose the role of DEFB 1 in prostate cancer tumor inununity. The data also show that the oncogenic factor PAX2 suppresses expression. One of the hallmarks of defensin cytotoxicity is the disruption of membrane integrity. The present results show that ectopic expression of DEFB1 in prostate cancer cells results in a loss of membrane potential due to compromised cell membranes. The same phenomenon is observed after inhibiting PAX2 protein expression. ChIP
analysis was also performed and confirmed that PAX2 is bound to the DEFB1 promoter resulting in the repression of DEFB 1 expression. Therefore, suppression of PAX2 expression or function, results in the re-establishment of DEFB 1 expression and subsequently DEFB 1-mediated cell death. Also, the present data establish the utility of DEFB 1 as a directed therapy for prostate cancer treatment through innate immunity.
Example IV
Expression of DEFB1 Results in Tumor Shrinkage The anti-tumoral ability of DEFB1 is evaluated by injecting tumor cells that overexpress DEFB1 into nude mice. DEFBl is cloned into pBI-EGFP vector, which has a bidirectional tetracycline responsible promoter. Tet-Off Cell lines are generated by transfecting pTet-Off into DU145, PC3 and LNCaP cells and selecting with G418.
The pBI-EGFP-DEFB 1 plasmid is co-transfected with pTK-Hyg into the Tet-off cell lines and selected with hygromycin. Only single-cell suspensions with a viability of >90% are used.
Each animal receives approximately 500,000 cells administered subcutaneously into the right flank of female nude mice. There are two groups, a control group injected with vector only clones and a group injected with the DEFB1 over-expressing clones. 35 mice are in each group as determined by a statistician. Animals are weighed twice weekly, tumor growth monitored by calipers and tumor volumes determined using the following formula:
volume = 0.5 x (width)2 x length. All animals are sacrificed by CO2 overdose when tumor size reaches 2 mm3 or 6 months following implantation; tumors are excised, weighed and stored in neutral buffered formalin for pathological examination. Differences in tumor growth between the groups are descriptively characterized through summary statistics and graphical displays. Statistical significance is evaluated with either the t-test or non-parametric equivalent.
Example V
Expression of PAX2 siRNA Results in Up-Regulation of DEFB1 Expression and Tumor Shrinkage In Vivo Hairpin PAX2 siRNA template oligonucleotides utilized in the in vitro studies are utilized to examine the effect of the up-regulation of DEFB 1 expression in vivo. The sense and antisense strand (see Table 4) are annealed and cloned into pSilencer 2.1 U6 hygro siRNA expression vector (Ambion) under the control of the human U6 RNA pol III
promoter. The cloned plasmid is sequenced, verified and transfected into PC3, Du145, and LNCap cell lines. Scrambled shRNA is cloned and used as a negative control in this study.
Hy.gromycin resistant colonies are selected, cells are introduced into the mice subcutaneously and tumor growth is monitored as described above.
Example VI
Small Molecule Inhibitors of PAX2 Binding Results in Up-Regulation of DEFB1 Expression and Tumor Shrinkage In Vivo The DNA recognition sequence for PAX2 binding resides in the DEFB1 promoter between nucleotides -75 and -71 [+1 refers to the transcriptional start site].
Short oligonucleotides complementary to the PAX2 DNA-binding domain are provided.
Examples of such oligonucleotides include the 20-mer and 40-mer oligonucleotides containing the GTTCC recognition sequence provided below. These lengths were randomly selected, and other lengths are expected to be effective as blockers of binding. As a negative control, oligonicleotides with a scrambled sequence (CTCTG) were designed to verify specificity. The oligonucleotides are transfected into the prostate cancer cells and the HPrEC cells with lipofectamine reagent or Codebreaker transfection reagent (Promega, Inc). In order to confirm DNA-protein interactions, double stranded oligonucleotides will be labeled with [32P] dCTP and electrophoretic mobility shift assays are performed. In addition, DEFB1 expression is monitored by QRT-PCR and Western analysis following treatment with oligonucleotides. Finally, cell death is detected by MTT assay and flow cytometry as previously described.
Recognition Sequence #1: CTCCCTTCAGTTCCGTCGAC (SEQ ID NO:9) Recognition Sequence #2: CTCCCTTCACCTTGGTCGAC (SEQ IDNO:10) Scramble Sequence #1: CTCCCTTCACTCTGGTCGAC (SEQ ID NO:11) Recognition Sequence #3:
ACTGTGGCACCTCCCTTCAGTTCCGTCGACGAGGTTGTGC (SEQ ID NO: 12) Recognition Sequence #4:
ACTGTGGCACCTCCCTTCACCTTGGTCGACGAGGTTGTGC (SEQ ID NO: 13) Scramble Sequence #2:
ACTGTGGCACCTCCCTTCACTCTGGTCGACGAGGTTGTGC (SEQ ID NO: 14) Further examples of oligonucleotides of the invention include:
Recognition Sequence #1: 5'-AGAAGTTCACCCTTGACTGT-3' (SEQ ID No:x) Recognition Sequence #2: 5'-AGAAGTTCACGTTCCACTGT-3' (SEQ ID No:x) Scramble Sequence #1: 5'-AGAAGTTCACGCTCTACTGT-3' (SEQ ID No:x) Recognition Sequence #3:
5'-TTAGCGATTAGAAGTTCACCCTTGACTGTGGCACCTCCC-3' (SEQ ID No:x) Recognition Sequence #4:
5'-GTTAGCGATTAGAAGTTCACGTTCCACTGTGGCACCTCCC-3' (SEQ ID No:x) Scramble Sequence #2:
5'-GTTAGCGATTAGAAGTTCACGCTCTACTGTGGCACCTCCC-3' (SEQ ID No:x) This set of alternative inhibitory oligonucleotides represents the recognition sequence (along with the CCTTG core sequence) for the PAX2 binding domain and homeobox. These include actual sequences from the DEFB1 promoter.
The PAX2 gene is required for the growth and survival of various cancer cells including prostate. In addition, the inhibition of PAX2 expression results in cell death mediated by the innate immunity component DEFB 1. Suppression of DEFB 1 expression and activity is accomplished by binding of the PAX2 protein to a GTTCC
recognition site in the DEFB 1 promoter. Therefore, this pathway provides a viable therapeutic target for the treatment of prostate cancer. In this method, the sequences bind to the PAX2 DNA binding site and block PAX2 binding to the DEFB 1 promoter thus allowing DEFB 1 expression and activity. The oligonucleotide sequences and experiment described above are examples of and demonstrate a model for the design of additional PAX2 inhibitor drugs.
Given that the GTTCC sequence exists in interleukin-3, interleukin-4, the insulin receptor and others, PAX2 regulates their expression and activity as well. Therefore the PAX2 inhibitors disclosed herein have utility in a number of other diseases including those directed related to inflaxmllation including prostatitis and benign prostatic hypertrophy (BPH).
Example VII
Loss of DEFB1 Expression Results in Increased Tumorigenesis Generation of Loss of Function Mice The Cre/loxP system has been useful in elucidating the molecular mechanisms underlying prostate carcinogenesis. Here a DEFB1 Cre conditional KO is used for inducible disruption within the prostate. The DEFB 1 Cre conditional KO involves the generation of a targeting vector containing loxP sites flanking DEFB 1 coding exons, targeted ES cells with this vector and the generation of germline chimeric mice from these targeted ES
cells.
Heterozygotes are mated to prostate-specific Cre transgenics and heterozygous intercross is used to generate prostate-specific DEFB 1 KO mice. Four genotoxic chemical compounds have been found to induce prostate carcinomas in rodents: N-methyl-N-nitrosourea (MNLT), N-nitrosobis 2-oxopropyl. amine (BOP), 3,2X-dimethyl-4-amino-biphenyl (MAB) and 2-amino-1 -methyl-6-plienylimidazow 4,5-bxpyridine (PhIP). DEFB1-transgenic mice are treated with these carcinogenic compounds via intra-gastric administration or i.v. injection for prostate adenoma and adenocarcinoma induction studies. Prostate samples are studied for differences in tumor growth and changes gene expression though histological, immunohistological, mRNA and protein analyses.
Generation of GOF mice For PAX2 inducible GOF mice, PAX2 GOF (bi-transgenic) and wild-type (mono-transgenic) littermates are administered doxycycline (Dox) from 5 weeks of age to induce prostate-specific PAX2 expression. Briefly, PROBASIN-rtTA mono-transgenic mice (prostate cell-specific expression of tet-dependent rtTA inducer) are crossed to our PAX2 transgenic responder lines. For induction, bi-transgenic mice are fed Dox via the drinking water (500 mg/L freshly prepared twice a week). Initial experiments verify low background levels, good inducibility and cell-type specific expression of PAX2 and the EGFP reporter using transgenic founder line in bi-transgenic mice. Regarding experimental group sizes, 5-7 age- and sex-matched individuals in each group (wild-type and GOF) allow for statistical significance. For all animals in this study, prostate tissues are collected initially at weekly intervals for analysis and comparison, to determine carcinogenic time parameters.
PCR Genotyping, RT-PCR and qPCR
PROBASIN-rtTA transgenic mice are genotyped using the following PCR primers and conditions: PROBASIN5 (forward) 5'-ACTGCCCATTGCCCAAACAC-3'; RTTA3 (reverse) 5'-AAAATCTTGCCAGCTTTCCCC-3'; 95 C denaturation for 5 min, followed by 30cycles of 95 C for 30 sec, 57 C for 30 sec, 72 C for 30 sec, followed by a 5 min extension at 72 C, yielding a 600 bp product. PAX2 inducible transgenic mice are genotyped using the 'following PCR primers and conditions: PAX2For 5'-GTCGGTTACGGAGCGGACCGGAG-3'; Rev5'1RES 5'-TAACATATAGACAAACGCACACCG-3'; 95 C denaturation for 5 min, followed by 34cycles of 95 C for 30 sec, 63 C for 30 sec, 72 C for 30 sec, followed by a 5 min extension at 72 C, yielding a 460 bp product. Immortomouse hemizygotes are be genotyped using the following PCR primers and conditions: hnmoll, 5'-GCGCTTGTGTC
GCCATTGTATTC-3'; Iinmol2, 5'-GTCACACCACAGAAGTAAGGTTCC-3'; 94 C 30 sec, 58 C 1 min, 72 C lmin 30 sec, 30 cycles to yield a-lkb transgene band.
For genotyping PAX2 knockout mice, the following PCR primers and conditions are used:
PAX2 For 5'-GTCGGTTACGGAGCGGACCGGAG-3'; PAX2Rev 5'-CACAGAGCATTGGCGATCTCGATGC-3'; 94 C 1 min, 65 C 1 min, 72 C 30 sec, 36 cycles to yield a 280 bp band.
DEFBI Peptide Aninaal Studies Six-week-old male athymic (nude) mice purchased from Charles River Laboratories are injected sub-cutaneously over the scapula with 106 viable PC3 cells. One week after injection, the animals are randomly allocated to one of three groups -group I:
control; group II: intraperitoneal injections of DEFB1, 100 g/day, 5 days a week, for weeks 2-14; group III: intraperitoneal injections of DEFB1, 100 mg/day, 5 days a week, for weeks 8-14.
Animals are maintained in sterile housing, four animals to a cage, and observed on a daily basis. At 10-day intervals, the tumors are measured by using calipers, and the volumes of the tumors are calculated by using V(L x W2)/2.
Appendix A
LOCUS HUMPAX201 7331 bp DNA linear PRI 28-JAN-2002 DEFINITION Homo sapiens paired-box protein (PAX2) gene, promoter and exon 1.
VERSION L09748.2 GI:18141563 KEYWORDS .
SEGMENT 1 of 3 SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Catarrhini;
Hominidae; Homo.
REFERENCE 1 (bases 7096 to 7291) AUTHORS Stapleton,P., Weith,A., Urbanek,P., Kozmik,Z. and Busslinger,M.
TITLE Chromosomal localization of seven PAX genes and cloning of a novel family member, PAX-9 JOURNAL Nat. Genet. 3(4), 292-298 (1993) REFERENCE 2(bases 1 to 7331) AUTHORS Pfeffer,P.L., Payer,B., Reim,G., di Magliano,M.P. and Busslinger,M.
TITLE The activation and maintenance of Pax2 expression at the mid-hindbrain boundary is controlled by separate enhancers JOURNAL Development 129 (2), 307-318 (2002) REFERENCE 3 (bases 7096 to 7291) AUTHORS Stapleton,P., Weith,A., Urbanek,P., Kozmik,Z. and Busslinger,M.
TITLE Direct Submission JOURNAL Submitted (12-JLTN-1993) Research Institute of Molecular Pathology, Dr. Bohr-Gasse 7, Vienna, Austria REFERENCE 4 (bases 1 to 7331) AUTHORS Pfeffer,P.L. and Busslinger,M.
TITLE Direct Submission JOURNAL Submitted (14-JAN-2002) Research Institute of Molecular Pathology, Dr. Bohr-Gasse 7, Vienna, Austria REIVIARK Sequence update by submitter COMMENT On Jan 14, 2002 this sequence version replaced gi:292378.
FEATURES Location/Qualifiers source 1..7331 /organism="Homo sapiens"
/mo1_type="genomic DNA"
/dbxref--"taxon:9606"
/chromosome=" 10"
/map=" 10q22.1-q24.3"
gene order(2034..7331,L09746.1:1..206,L09747.1:1..>238) /gene="PAX2"
enhancer 2034..2518 /gene="PAX2"
/note="distal (late) enhancer"
enhancer 2850..2974 /gene="PAX2"
/note="intermediate (early) enhancer"
enhancer 3516..3898 /gene="PAX2"
/note="proximal (late) enhancer"
mRNA join(6532..7271,L09746.1:21..186,L09747.1:21.>218) /gene="PAX2"
/product="paired-box protein"
exon 6532..7271 /gene="PAX2"
/numbeY=1 CDS join(7229..7271,L09746.1:21..186,L09747.1:21..>218) /gene="PAX2"
/codon_start=1 /product="paired-box protein"
/protein_id="AAC41711.1 "
/db xref--"GI:553607"
/translation="NIDMHCKADPFSAIVIHRHGGVNQLGGVFVNGRPLPDV VRQRIVELA
HQGVRPCDISRQLRV SHGCV SKILGRYYETGSIKPGV IGGSKPKVATPKV VDKIAEY
KRQNPTMFAWEIRDRLLAEGICDNDTVPSVS SIN"
ORIGIN
1 ttcccccttt ccangagggc ctaatccgtt gcgcgcgcgc acgcggacac acacacacac 61 acacacacac acacacacac acacacggcc cccatagcca ccgcaactct cagcagcagn 121 ncctagctcc tctgacccga ggccccaaga cggcgggcac aggaacccct gggacgtcct 181 ggctccaggc tggacgtagg cggaggtggc aggagtggac aaacccaggc gggtcccacg 241 acgccccttt cctcgggtct ctccttgttt cagccagccg ctctcgcccc tggtcccctc 301 ttccctgcgt tagggtcctt tgtctccagc cacctcgcag cctgtccccg cctcggcggc 361 cctgcccttt gggcctccca gatctctctg gcgggtcccc ctgccttacc agctcccggc 421 tgtggcgcgc tcttcgcctg ctcctcacat ncacacagct gctgggagag gaggaaggaa 481 aggcggncgc gccgcggatg gatccgagac ggtagatttg gtgccggctc gcaaactctg 541 ggaaacttaa ngccggttct tccgcccctc tncaactatg nccagcgcgg cccggtcgcg 601 cgcgctcacc ccgcggggac cctttccttt tcctgtattt cggctgcggc tgtttcgctt 661 cctctggtct cccagccttt ggagtggctt ccctggccct gcactccgtt ccctttcggc 721 cgcccccggc tgtcgcctgc ccccaccctc cgcaggtccc acggtcgcgg cggcgatgac 781 tgtggaggta acgccgggga cgtcctgggt cagcctgcac cgtctccctc gaccacagcc 841 cgatgaggcc gcgggctccg ggccggctgc taagagagtt aatcattact tcgccagcga 901 cactcagcct ccccttccga ctctctcgcc cggcctaggg gaggagggga ggggacagct 961 ggccaggtgg ggacttcggc ttcgcacaaa ccagcctctt caggcctccc agagacaggt 1021 ggtggcttct cagttccctc ggcaactctc taaggtcctc tttcttcccc tcctgtctct 1081 ccctccttcg agcctcctcc cagccaggcc tctccccacc gtctcctgtc cgctctggct 1141 ttgactgatt aactgcaggt cctgggagaa ccaactttct ttgtttggaa ccggaccgga 1201 cgggatttcc ttccctaggt ctccgccaat gggccagctc ctcccgacgg ttttggcgga 1261 ctggctgaag aggaccgcgc ctgaggccac aattaacccg gctgttggtg gtggtggttg 1321 gggggtgggc agtgaggaat ttaaccgatc ctctagcagc tgcgctggtg cagttgggag 1381 gggggtgcag gaagtgggaa tggaggagtg gcaggaggta tagacagagg gaagaacgat 1441 aaacctggac aggtgtggca tagccaatag aaggggaaac aaaataaaac aggaaggcgg 1501 cgcggggagg aatccccagt aacctttata ggattgaagt tgggtggaaa acgccacctc 1561 ctgccctacc ttagcactca gatccctcct ttacctcttt gtgaaagggt aagagttcag 1621 aaagctggcc atttactcca taatctacta gagaaatgtc tgggtttgca aaatgcctat 1681 tgattagctc catggagtag acaagacagg cgtaattatc cccattttac aggtgagaaa 1741 actgagtctc aaagaagcaa agggactgtg tatgtagtgg ctgtcacttt ttcctgtagg 1801 ctgtggggtg agtggcccct ttagctgtgc agaggtccat gggtatctag ggaggcggta 1861 caggctgtgt ccaggtctga gccagaagta ccagggcctc acggggctcc tagccctttt 1921 agcttgttct ctgttggaca ggaccttcac tcttactctc tagacctgct ggctgggttt 1981 ctcccagctt cgctattttt tcagttccct agtagagtgg cccatgggcg gtagccacct 2041 ggctggcccg tgccactaag aggcagcttt ggtggccaag tggcttgcat tgttgttgct 2101 cctcaaaggg cctgtgaagg gctgggcagg tcgcaaagac ctcttgtgag gggaaagcta 2161 gattaaaggg ggtaaggatc ctggaggata aaggccaagc acgtgcgcct ggactccaca 2221 ggaccaacag accgagcggg cggggccngc tgggagtcag gccccccggg cttcacgcag 2281 ggagcccaaa tattgggaac aaaagcagga aaagaagagt gagagcagga gggagggagg 2341 gagcgaggaa gcagaaatta gggggtctta gatgaaaaaa aaaagaaagt agctttaggg 2401 ggaatgtgct gtggagtgtg aaattgcagc ccatggtgct ccatattgta ccagaagctc 2461 ttccaaaaaa aaaaaaaaaa accatcctcc aacgtgacca gagggccagg cagggggaag.
2521 ggcggggaga gaatggggag gaggaggggg aaaggccggg caggagccgg tcaggccttt 2581 ctgcggaagg ggctggggtg taagtttcgg ctccctggga tctgacagcc gagggtatgc 2641 gccctggggt gcgccgggac ccagagggcg agtgagcctc ggttggtcgg ctctggagtt 2701 cggttgtcag aagaactttt atttttcttt ttggtggtga cttctaaaag tgggaataat 2761 ccagaaatga agctcagctg cggagctgca gctctgttct ccctctctcc cctgcctttc 2821 tgcttctctt cccttcggac tacttttctc cccttggttc taaatagctt tttcccctct 2881 gaactttaat gcatttaatt tggtccgcgc tgtggggagc atttcctggg gagatgcatt 2941 taatttcgga atttctaatc ccctccctca gaccccggtc ctagctcccc tagccgctcc 3001 ccgggaagtg gaaggaggaa ggcaggtccc ggccacgggg gaggggcgcg gctgggatgc 3061 tcccgcggcc ccctccgtct caccaaggct cagccgcctt cccaagctac tggaggccgg 3121 gcgcctgggc cccgggtcag ggccctgcan gaagaagaga ggcaaccccc gctttctgcc 3181 ttttcttcgc ctgggcaaga aaacgctggg ccagggaact ggaaaccgga aaacaggaga 3241 aagggtttnt ggaaggcanc gggagcgggt ggcagncggg gcancgggca ntggactagg 3301 tctacaccgg cacttcactt ttgcacaaca tgcccagaaa cgcatttgag agccctggag 3361 tcgcgcttgg cttggcttgg ggcgccggtg cgtgggtaca ctcgaggtcg gggtgcctat 3421 ccgccacccc gacacctaca cccagtgcag agcaggcgcg gcccagccag acaaccaggc 3481 cggcagtagc tcggcctgga gggcggaggc aaggttgggg gccgccaggc gcctgggcaa 3541 gcctggcagg gaagggagcc gagaaggcaa aggagccgag atccacaagg aagattnntt 3601 gggcagatca gatgcacaga ggcggctaat gaagcaaatc ccgagatggg tttcagagca 3661 actccccaaa agtttatttt gcctttaaat ttccgcaggg aggcgggctc cttgtttgaa 3721 gtgtaaatgc ccctaggttg gggggtggaa gggccgcttt gaaaacacca gagagaaaag 3781 gttcatttag aggcggacgg gaaaagcaac caaccctgac aggtcggagc ccgggtagtg 3841 tttggggttg ggtngttttc tttctttctc tttcttttcc cctttcctct tctttcttcc 3901 cttttgtgnn ttttnnttgt tttttttntn ttntttttnt ttaantggct ttcttgcttc ,3961 cccccacccc tctactagac tctatagaag aaagagaaca gaaaaggggg agtcagagga 4021 gcggccagtg actggatgaa ggccagccct tcatcctgga gccccaggag aaggcagagc 4081 tttggagaaa aggggttcct aatctccagg gagcattact ctttgactct ctagacccag 4141 gaatgggctg gacgctaatg gggaagcggc caggaacccg gcctggcgga agagtgagtg 4201 tccagctagt gcagtgctgg gaagacgatc ccaggagcag gggggactct caggggctac 4261 ctgggaatgg gactatcaga agggtcttta ctcctcanaa ggtgcatgtg aaggacaggt 4321 gtgtgaggac aacttccagc acacttggcg cattaagtcc ccttctctac aaaatggaaa 4381 atccttctcg cccaacatgt gaaaatgctt gttgtgggca cccacatttc atggtacttg 4441 taacatagga catgtctagc tggttctaga aaaatctgtg tctgtgtgga aggggggggg 4501 tttactcaca gctttcttcc ttcaatagtt cacacacccc gagacaaatt cctggatgac 4561 caacttggag agacctgggg caaaggttac tttagttctg agctcctcta aataaggacc 4621 ctttctcaac gttcctttca ccccagttct gggttaatta cttccagtta gtgcgtgttc 4681 gtggggttgt gaggccaaag caaacccggg agcgccatct gcaggcctca agaggaagag 4741 actgacctta gaggctaggc cctgcgtctt caacctctag cccaagggaa ccaacctgcc 4801 tagccaccca agggaagtgg gataggggct gggaggggca ggcggtgagg agtgttttcc 4861 tcccagactt taccccgcag gtggattaag cttattgggc tctggaggat acaggaggga 4921 gggcaaatgc caggatccca gcggacccag gccccacagg agtgagaggc tcagaacctc 4981 gtcccgctga gcctggcctg agctcctcct gaggaataag ggcatcccaa aaacccgggt 5041 acaagacgcc cagtagtagt agttaggctg agtcaggcag gtgcatctct ccccatggta 5101 tctgccgccc aggctccggc cagagggagg ggagcgcgag tccgcggcgc ttccgcgggg 5161 cgcccggaac tgcagacggg ggctggagga atctcggatt cgggctgcaa gagcgctgcg 5221 caagcttcgc cgagccgccc tttcgcagac ccagggaagc ggggggaggg agcgaaggag 5281 ggagagagag ttaaaacatc agcttgaaag tgcccaagat gattttatta agaccgaggg 5341 gaaaattatt ttcatgaaag attctccccg gaatatttct tgtacttaac ccagttagga 5401 agacaaaggg cttctttctg cctggtgcgg tgcgagcgga ccccagcgag caagggagct 5461 agtgccaaag agaactgcgg aggctccggc aggagtgggg acgtccccgt ggttgcgcct 5521 cctgcgctcg ccccggatcc accgagctag cagcgggcgg cgctcagccg cgtccgcagc 5581 ctcctcttct ccccagccgg ggagagccag cctcgtctcc cacatcctct gccgccagcg 5641 acctgcagct ccgcactgtt tccctcccct gtaccccctt cccagtcacc cgagggttca 5701 gaaaccaagt cccccggctc tcccgccatc cgctgggtcc caccgaggca ggtgggtact 5761 cgccggaggt cttcagctcg attctgaacc aagcgttctg gactgcccag acccggtggg 5821 caaggggact ggggaggccc tgcgcacagt cgcgtggaac gggaggggac aagacaaact 5881 gctggacact tttccgtgga atgagaagtg gggggtgcgt gggtgggaag gtacctccgg 5941 agggaaaggc caaagggaag gaccagaaag agaggaagga agagccggga aggaacggaa 6001 gggaactcag agccgagggt ggtggggttg gggctaggga tgcgcactgg gcccggggcc 6061 gcgcggccca ggcgggcact ggccagtgga tggcagggct gggcgagtta gaactgagag 6121 cccggcttca cagcgcagcg cgctccgagg ccctctgtcg ttacctgaat attcattaga 6181 ctgaccgctc tttatcctta tctaacgttt atcttatcgg cgagtttcgt ttctcagtgt 6241 agttttaatc ccgggctccc attccccctc ccccggtccg ctcccctccc tccctcttcc 6301 ttcgccggct gctccctccc tccctccctc ccatttctcc ctcccctgcc ctccccttgc 6361 cggcaccgga gtgacaggct cggggccctc ctcgccgaag ctcggggctc cagcgctggc 6421 gaatcacaga gtggtggaat ctattgcctt tgtctgacaa gtcatccatc tcccggcgcg 6481 gggaggggga ggaggtctgg agggggcttt gcagctttta gagagacaca caccgggagc 6541 cgaggctcca gtctccggcc gagtcttcta gcagccgcaa cccacctggg gccagcccag 6601 agctgccagc gccgctcggc tccctccctc cctcccggcc cttcggccgc ggcggcgtgc 6661 gcctgccttt tccgggggcg ggggcctggc ccgcgcgctc ccctcccgca ggcgccacct 6721 cggacatccc cgggattgct acttctctgc caacttcgcc aactcgccag cacttggaga 6781 ggcccggctc ccctcccggc gccctctgac cgcccccgcc ccgcgcgctc tccgaccacc 6841 gcctctcgga tgaacaggtt ccaggggagc tgagcgagtc gcctcccccg cccagcttca 6901 gccctggctg cagctgcagc gcgagccatg cgcccccagt gcaccccggc ccggcccacc 6961 gccccggggc cattctgctg accgcccagc cccgagcccc gacagtggca agttgcggct 7021 actgcggttg caagctccgg ccaacccgga ggagccccag cggggagcgc agtgttgcgc 7081 cccccgcccc cgcgcgcgcc gcagcagccg ggcgttcact catcctccct cccccaccgt 7141 ccctcccttt tctcctcaag tcctgaagtt gagtttgaga ggcgacacgg cggcggcggc 7201 cgcgctgctc ccgctcctct gcctccccat ggatatgcac tgcaaagcag accccttctc 7261 cgcgatgcac cgtgagtacc cgcgcccggc tcctgtcccg gctcgggctc tccgtcccaa 7321 ccctgtccag t Appendix B
LOCUS NM_003987 4276 bp mRNA linear PRI 24-SEP-2005 DEFINITION Homo sapiens paired box gene 2 (PAX2), transcript variant a, mRNA.
ACCESSION NM_003987 VERSION NM_003987.2 GI:34878698 KEYWORDS .
SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Catarrhini;
Hominidae; Homo.
REFERENCE 1(bases 1 to 4276) AUTHORS Yoshimura,K., Yoshida,S., Yamaji,Y., Komori,A., Yoshida,A., Hatae,K., Kubota,T. and Ishibashi,T.
TITLE De novo insG619 mutation in PAX2 gene in a Japanese patient with papillorenal syndrome JOURNAL Am. J. Ophthalmol. 139 (4), 733-735 (2005) REMARK GeneRIF: Molecular genetic analysis of the PAX2 gene in combination with renal ultrasonography can help in making an earlier diagnosis of the disease.
REFERENCE 2 (bases 1 to 4276) AUTHORS Mazal,P.R., Stichenwirth,M., Koller,A., Blach,S., Haitel,A. and Susani,M.
TITLE Expression of aquaporins and PAX-2 compared to CD 10 and cytokeratin 7 in renal neoplasms: a tissue microarray study JOU.RNAL Mod. Pathol. 18 (4), 535-540 (2005) REMARK GeneRIF: PAX-2 is a reliable marker for clear cell renal cell carcinomas of lower grades but not for higher grades.
REFERENCE 3 (bases 1 to 4276) AUTHORS Higashide,T., Wada,T., Sakurai,M., Yokoyama,H. and Sugiyama,K.
TITLE Macular abnormalities and optic disk anomaly associated with a new PAX2 missense mutation JOURNAL Am. J. Ophthalmol. 139 (1), 203-205 (2005) REMARK GeneRIF: A new PAX2 missense mutation, R71T, may cause macular abnormalities in addition to anomalies of the optic disk and the kidney.
REFERENCE 4 (bases 1 to 4276) AUTHORS Buttiglieri,S., Deregibus,M.C., Bravo,S., Cassoni,P., Chiarle,R., Bussolati,B. and Camussi,G.
TITLE Role of Pax2 in apoptosis resistance and proinvasive phenotype of Kaposi's sarcoma cells JOURNAL J. Biol. Chem. 279 (6), 4136-4143 (2004) REMARK GeneRIF: expression of Pax2 by Kaposi's sarcoma cells correlated with an enhanced resistance against apoptotic signals and with the proinvasive phenotype REFERENCE 5 (bases 1 to 4276) AUTHORS Brophy,P.D., Lang,K.M. and Dressler,G.R.
TITLE The secreted frizzled related protein 2(SF.RP2) gene is a target of the Pax2 transcription factor JOURNAL J. Biol. Chem. 278 (52), 52401-52405 (2003) REMARK GeneRIF: Pax2 protein regulates expression of secreted frizzled related protein 2 REFERENCE 6 (bases 1 to 4276) AUTHORS Schimmenti,L.A., Manligas,G.S. and Sieving,P.A.
TITLE Optic nerve dysplasia and renal insufficiency in a family with a novel PAX2 mutation, Argl 15X: further ophthalmologic delineation of the renal-coloboma syndrome JOURNAL Ophthalmic Genet. 24 (4), 191-202 (2003) REMARK GeneRIF: PAX2 mutation is associated with Optic nerve dysplasia and renal insufficiency of the renal-coloboma syndrome REFERENCE 7 (bases 1 to 4276) AUTHORS Muratovska,A., Zhou,C., He,S., Goodyer,P. and Eccles,M.R.
TITLE Paired-Box genes are frequently expressed in cancer and often required for cancer cell survival JOURNAL Oncogene 22 (39), 7989-7997 (2003) REMARK GeneRIF: The PAX2 gene was frequently expressed in a panel of 406 common primary tumor tissues and endogenous PAX gene expression is often required for the growth and survival of cancer cells REFERENCE 8 (bases 1 to 4276) AUTHORS Gough,S.M., McDonald,lV1., Chen,X.N., Korenberg,J.R., Neri,A., Kahn,T., Eccles,M.R. and Morris,C.M.
TITLE Refined physical map of the human PAX2/HOX11/NFKB2 cancer gene region at 10q24 and relocalization of the HPV6AI1 viral integration site to 14q13.3-q21.1 JOURNAL BMC Genomics 4 (1), 9 (2003) REFERENCE 9 (bases 1 to 4276) AUTHORS Hoffineister,A., Ropolo,A., Vasseur,S., Mallo,G.V., Bodeker,H., Ritz-Laser,B., Dressler,G.R., Vaccaro,M.I., Dagorn,J.C., Moreno,S.
and Iovanna,J.L.
TITLE The HMG-UY-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter JOURNAL J. Biol. Chem. 277 (25), 22314-22319 (2002) E2EMARK GeneRIF: The HMG-UY-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter.
REFERENCE 10 (bases 1 to 4276) AUTHORS Cai,Y., Lechner,M.S., Nihalani,D., Prindle,M.J., Holzman,L.B. and Dressler,G.R.
TITLE Phosphorylation of Pax2 by the c-Jun N-terminal kinase and enhanced Pax2-dependent transcription activation JOURNAL J. Biol. Chem. 277 (2), 1217-1222 (2002) REFERENCE 11 (bases 1 to 4276) AUTHORS Becker,K., Beales,P.L., Calver,D.M., Matthijs,G. and Mohammed,S.N.
TITLE Okihiro syndrome and acro-renal-ocular syndrome: clinical overlap, expansion of the phenotype, and absence of PAX2 mutations in two new families JOURNAL J. Med. Genet. 39 (1), 68-71 (2002) REMARK GeneRIF: The absence of PAX2 mutations has been identified in two families with histories of clinical overlap of Okihiro and acro-renal-ocular syndromes.
REFERENCE 12 (bases 1 to 4276) AUTHORS Eccles,M.R., He,S., Legge,M., Kumar,R., Fox,J., Zhou,C., French,M.
and Tsai,R.W.
TITLE PAX genes in development, and disease: the role of PAX2 in urogenital tract development JOURNAL Int. J. Dev. Biol. 46 (4), 535-544 (2002) REMARK Review article GeneRIF: PAX2 has a role in urogenital tract development and disease [review]
REFERENCE 13 (bases 1 to 4276) AUTHORS Chung,G.W., Edwards,A.O., Schimmenti,L.A., Manligas,G.S., Zhang,Y.H. and Ritter,R. III.
TITLE Renal-coloboma syndrome: report of a novel PAX2 gene mutation JOURNAL Am. J. Ophthalmol. 132 (6), 910-914 (2001) REMARK GeneRIF: The causal relationship between PAX2 gene mutations and renal-coloboma syndrome is further supported REFERENCE 14 (bases 1 to 4276) AUTHORS Nishimoto,K., Iijima,K., Shirakawa,T., Kitagawa,K., Satomura,K., Nakamura,H. and Yoshikawa,N.
TITLE PAX2 gene mutation in a family with isolated renal hypoplasia JOURNAL J. Am. Soc. Nephrol. 12 (8), 1769-1772 (2001) REFERENCE 15 (bases 1 to 4276) AUTHORS Ritz-Laser,B., Estreicher,A., Gauthier,B. and Philippe,J.
TITLE The paired homeodomain transcription factor Pax-2 is expressed in the endocrine pancreas and transactivates the glucagon gene promoter JOURNAL J. Biol. Chem. 275 (42), 32708-32715 (2000) REFERENCE 16 (bases 1 to 4276) AUTHORS Lechner,M.S., Levitan,I. and Dressler,G.R.
TITLE PTIP, a novel BRCT domain-containing protein interacts with Pax2 and is associated with active chromatin JOURNAL Nucleic Acids Res. 28 (14), 2741-2751 (2000) REFERENCE 17 (bases 1 to 4276) AUTHORS Tavassoli,K., Ruger,W. and Horst,J.
TITLE Alternative splicing in PAX2 generates a new reading frame and an extended conserved coding region at the carboxy terminus JOURNAL Hum. Genet. 101 (3), 371-375 (1997) REFERENCE 18 (bases 1 to 4276) AUTHORS Dahl,E., Koseki,H. and Balling,R.
TITLE Pax genes and organogenesis JOURNAL Bioessays 19 (9), 755-765 (1997) RElVIARK Review article REFERENCE 19 (bases 1 to 4276) AUTHORS Schimmenti,L.A., Cunliffe,H.E:, McNoe,L.A., Ward,T.A., French,M.C., Shim,H.H., Zhang,Y.H., Proesmans,W., Leys,A., Byerly,K.A., Braddock,S.R., Masuno,M., Imaizumi,K., Devriendt,K. and Eccles,M.R.
TITLE Further delineation of renal-coloboma syndrome in patients with extreme variability of phenotype and identical PAX2 mutations JOURNAL Am. J. Hum. Genet. 60 (4), 869-878 (1997) REFERENCE 20 (bases 1 to 4276) AUTHORS Narahara,K., Baker,E., Ito,S., Yokoyama,Y., Yu,S., Hewitt,D., Sutherland,G.R., Eccles,M.R. and Richards,R.I.
TITLE Localisation of a 10q breakpoint within the PAX2 gene in a patient with a de novo t(10;13) translocation and optic nerve coloboma-renal disease JOURNAL J. Med. Genet. 34 (3), 213-216 (1997) REFERENCE 21 (bases 1 to 4276) AUTHORS Dehbi,M., Ghahremani,M., Lechner,M., Dressler,G. arid Pelletier,J.
TITLE The paired-box transcription factor, PAX2, positively modulates expression of the Wilms' tumor suppressor gene (WT1) JOURNAL Oncogene 13 (3), 447-453 (1996) REFERENCE 22 (bases 1 to 4276) AUTHORS Sanyanusin,P., Norrish,J.H., Ward,T.A., Nebel,A., McNoe,L.A. and Eccles,M.R.
TITLE Genomic structure of the human PAX2 gene JOURNAL Genomics 35 (1), 258-261 (1996) REFERENCE 23 (bases 1 to 4276) AUTHORS Sanyanusin,P., Schimmenti,L.A., McNoe,L.A., Ward,T.A., Pierpont,M.E., Sullivan,M.J., Dobyns,W.B. and Eccles,M.R.
TITLE Mutation of the PAX2 gene in a family with optic nerve colobomas, renal anomalies and vesicoureteral reflux JOURNAL Nat. Genet. 9(4), 358-364 (1995) REFERENCE 24 (bases 1 to 4276) AUTHORS Ward,T.A., Nebel,A., Reeve,A.E. and Eccles,M.R.
TITLE Alternative messenger RNA forms and open reading frames within an additional conserved region of the human PAX-2 gene JOURNAL Cell Growth Differ. 5(9), 1015-1021 (1994) REFERENCE 25 (bases 1 to 4276) AUTHORS Noll,M.
TITLE Evolution and role of Pax genes JOURNAL Curr. Opin. Genet. Dev. 3(4), 595-605 (1993) RElVIARK Review article REFERENCE 26 (bases 1 to 4276) AUTHORS Stapleton,P., Weith,A., Urbanek,P., Kozmik,Z. and Busslinger,M.
TITLE Chromosomal localization of seven PAX genes and cloning of a novel family member, PAX-9 JOURNAL Nat. Genet. 3 (4), 292-298 (1993) REFERENCE 27 (bases 1 to 4276) AUTHORS Pilz,A.J., Povey,S., Gruss,P. and Abbott,C.M.
TITLE Mapping of the human homologs of the murine paired-box-containing genes JOURNAL Marnm. Genome 4 (2), 78-82 (1993) REFERENCE 28 (bases 1 to 4276) AUTHORS Eccles,M.R., Wallis,L.J., Fidler,A.E., Spurr,N.K., Goodfellow,P.J.
and Reeve,A.E.
TITLE Expression of the PAX2 gene in human fetal kidney and Wi1ms' tumor JOURNAL Cell Growth Differ. 3(5), 279-289 (1992) COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from U45255.1 and BM671839.1.
On Sep 22, 2003 this sequence version replaced gi:4557822.
Summary: PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1.
Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.
Transcript Variant: This variant (a) uses an alternate in-frame splice site in the 3' coding region, compared to variant e, resulting in a shorter protein (isoform a) that has a shorter, distinct C-terminus compared to isoform e.
COMPLETENESS: complete on the 3' end.
FEATURES Location/Qualifiers source 1..4276 /organism="Homo sapiens"
/mol_type="mRNA"
/db_xref-~"taxon:9606"
/chromosome=" 10"
/map=" 10c124"
gene 1..4276 /gene="PAX2"
/dbxref--"GeneID : 5 076"
/db_xref--"HGNC:8616"
/db_xref--"MIM:167409"
CDS 687..1937 /gene="PAX2"
/note="PAX2 gene is- a member of the paired-box containing genes which encode transcription factors involved in embryonic and fetal development; the gene product is nuclear protein which binds DNA
isoform a is encoded by transcript variant a; paired box homeotic gene 2;
go_component: nucleus [goid 0005634] [evidence IEA];
go_function: ATP binding [goid 0005524] [evidence IEA];
go_function: DNA binding [goid 0003677] [evidence IEA];
go_function: DNA binding [goid 0003677] [evidence TAS]
[pmid 9106533];
go_function: nucleoside diphosphate kinase activity [goid 0004550] [evidence IEA];
go_process: development [goid 0007275] [evidence IEA];
go_process: transcription [goid 0006350] [evidence IEA];
go_process: CTP biosynthesis [goid 0006241] [evidence IEA];
go_process: GTP biosynthesis [goid 0006183] [evidence IEA];
go_process: UTP biosynthesis [goid 0006228] [evidence IEA];
go_process: axonogenesis [goid 0007409] [evidence TAS]
[pmid 9106533];
go_process: cell differentiation [goid 0030154] [evidence lEA];
go_process: visual perception [goid 0007601] [evidence TAS] [pmid 9106533];
go_process: regulation of transcription, DNA-dependent [goid 0006355] [evidence IEA];
go_process: transcription from RNA polymerase II promoter [goid 0006366] [evidence TAS] [pmid 8760285]"
/codon_start=l /product="paired box protein 2 isoform a"
/protein_id="NP_003978.2"
/dbxref="GI:34878699"
/db_xref--"GeneID: 5 076"
/dbxref--"HGNC:8616"
/db xref-'-"MINI:167409"
/translation="MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPD V VRQRIVELAH
QGVRPCDISRQLRV SHGC V SKILGRYYETGSIIKPGVIGGSKPKVATPKV VDKIAEYK
RQNPTMFAWEIRDRLLAEGICDNDTVPS VS SINRIIRTKVQQPFHPTPDGAGTGVTA
PGHTIVPSTASPPV SSASNDPVGSYSINGILGIPRSNGEKRKRDEVEVYTDPAHIRGG
GGLHLVWTLRDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSY
PDVFQASEHIKSEQGNEYS LPALTPGLDEVKS SLSASTNPELGSNVS GTQTYPV VTG
RDMASTTLPGYPPHVPPTGQGSYPTSTLAGMVPGSEFSGNPYSHPQYTAYNEAWRF
SNPALL
SSPYYYSAAPRSAPAAAAAAYDRH"
STS 1926..2132 /gene="PAX2"
/standardname="R.H80285"
/db_xref--"UniSTS :88437"
STS 3124..3276 /gene="PAX2"
/standardname="D 10S2478"
/db_xref="UniSTS:74159"
polyA signal 4230..4235 /gene="PAX2"
polyA_signal 4234..4239 /gene="PAX2"
polyA signal 4241..4246 /gene="PAX2"
polyA site 4259 /gene="PAX2"
ORIGIN
1 aggctccagt ctccggccga gtcttctcgc agccgcaacc cacctggggc cagcccagag 61 ctgccagcgc cgctcggctc cctccctccc tcccggccct tcggccgcgg cggcgtgcgc 121 ctgccttttc cgggggcggg ggcctggccc gcgcgctccc ctcccgcagg cgccacctcg 181 gacatccccg ggattgctac ttctctgcca acttcgccaa ctcgccagca cttggagagg 241 cccggctccc ctcccggcgc cctctgaccg cccccgcccc gcgcgctctc cgaccaccgc 301 ctctcggatg accaggttcc aggggagctg agcgagtcgc ctcccccgcc cagcttcagc 361 cctggctgca gctgcagcgc gagccatgcg cccccagtgc accccggccc ggcccaccgc 421 cccggggcca ttctgctgac cgcccagccc cgagccccga cagtggcaag ftgcggctac 481 tgcagttgca agctccggcc aacccggagg agccccagcg gggagcgcag tgttgcgccc 541 cccgcccccg cgcgccccgc agcagccggg cgttcactca tcctccctcc cccaccgtcc 601 ctcccttttc tcctcaagtc ctgaagttga gtttgagagg cgacacggcg gcggcggccg 661 cgctgctccc gctcctctgc ctccccatgg atatgcactg caaagcagac cccttctccg 721 cgatgcaccc agggcacggg ggtgtgaacc agctcggggg ggtgtttgtg aacggccggc 781 ccctacccga cgtggtgagg cagcgcatcg tggagctggc ccaccagggt gtgcggccct 841 gtgacatctc ccggcagctg cgggtcagcc acggctgtgt cagcaaaatc ctgggcaggt 901 actacgagac cggcagcatc aagccgggtg tgatcggtgg ctccaagccc aaagtggcga 961 cgcccaaagt ggtggacaag attgctgaat acaaacgaca gaacccgact atgttcgcct 1021 gggagattcg agaccggctc ctggccgagg gcatctgtga caatgacaca gtgcccagcg 1081 tctcttccat caacagaatc atccggacca aagttcagca gcctttccac ccaacgccgg 1141 atggggctgg gacaggagtg accgcccctg gccacaccat tgttcccagc acggcctccc 1201 ctcctgtttc cagcgcctcc aatgacccag tgggatccta ctccatcaat gggatcctgg 1261 ggattcctcg ctccaatggt gagaagagga aacgtgatga agttgaggta tacactgatc 1321 ctgcccacat tagaggaggt ggaggtttgc atctggtctg gactttaaga gatgtgtctg 1381 agggctcagt ccccaatgga gattcccaga gtggtgtgga cagtttgcgg aagcacttgc 1441 gagctgacac cttcacccag cagcagctgg aagctttgga tcgggtcttt gagcgtcctt 1501 cctaccctga cgtcttccag gcatcagagc acatcaaatc agaacagggg aacgagtact 1561 ccctcccagc cctgacccct gggcttgatg aagtcaagtc gagtctatct gcatccacca 1621 accctgagct gggcagcaac gtgtcaggca cacagacata cccagttgtg actggtcgtg 1681 acatggcgag caccactctg cctggttacc cccctcacgt gccccccact ggccagggaa 1741 gctaccccac ctccaccctg gcaggaatgg tgcctgggag cgagttctcc ggcaacccgt 1801 acagccaccc ccagtacacg gcctacaacg aggcttggag attcagcaac cccgccttac 1861 taagttcccc ttattattat agtgccgccc cccggtccgc ccctgccgct gctgccgctg 1921 cctatgaccg ccactagtta ccgcggggac cacatcaagc ttcaggccga cagcttcggc 1981 ctccacatcg tccccgtctg accccacccc ggagggaggg aggaccgacg cgacgcgatg 2041 cctcccggcc accgccccag cctcacccca tcccacgacc cccgcaaccc ttcacatcac 2101 ccccctcgaa ggtcggacag gacgggtgga gccgtgggcg ggaccctcag gcccgggccc 2161 gccgccccca gccccgcctg ccgcccctcc ccgcctgcct ggactgcgcg gcgccgtgag 2221 ggggattcgg cccagctcgt cccggcctcc accaagccag ccccgaagcc cgccagccac 2281 cctgccggac tcgggcgcga cctgctggcg cgcgccggat gtttctgtga cacacaatca 2341 gcgcggaccg cagcgcggcc cagccccggg cacccgcctc ggacgctcgg gcgccaggag 2401 gcttcgctgg aggggctggg ccaaggagat taagaagaaa acgactttct gcaggaggaa 2461 gagcccgctg ccgaatccct gggaaaaatt cttttccccc agtgccagcc ggactgccct 2521 cgccttccgg gtgtgccctg tcccagaaga tggaatgggg gtgtgggggt ccggctctag 2581 gaacgggctt tgggggcgtc aggtctttcc aaggttggga cccaaggatc ggggggccca 2641 gcagcccgca ccgatcgagc cggactctcg gctcttcact gctcctcctg gcctgcctag 2701 ttccccaggg cccggcacct cctgctgcga gacccggctc tcagccctgc cttgccccta 2761 cctcagcgtc tcttccacct gctggcctcc cagtttcccc tcctgccagt ccttcgcctg 2821 tcccttgacg ccctgcatcc tcctccctga ctcgcagccc catcggacgc tctcccggga 2881 ccgccgcagg accagtttcc atagactgcg gactggggtc ttcctccagc agttacttga 2941 tgccccctcc cccgacacag actctcaatc tgccggtggt aagaaccggt tctgagctgg 3001 cgtctgagct gctgcggggt ggaagtgggg ggctgcccac tccactcctc ccatcccctc 3061 ccagcctcct cctccggcag gaactgaaca gaaccacaaa aagtctacat ttatttaata 3121 tgatggtctt tgcaaaaagg aacaaaacaa cacaaaagcc caccaggctg ctgctttgtg 3181 gaaagacggt gtgtgtcgtg tgaaggcgaa acccggtgta cataacccct ccccctccgc 3241 cccgccccgc ccggccccgt agagtccctg tcgcccgccg gccctgcctg tagatacgcc 3301 ccgctgtctg tgctgtgaga gtcgccgctc gctggggggg aaggggggga cacagctaca 3361 cgcccattaa agcacagcac gtcctggggg aggggggcat tttttatgtt acaaaaaaaa 3421 attacgaaag aaaagaaatc tctatgcaaa atgacgaaca tggtcctgtg gactcctctg 3481 gcctgttttg ttggctcttt ctctgtaatt ccgtgttttc gctttttcct ccctgcccct 3541 ctctccctct gcccctctct cctctccgct tctctccccc tctgtctctg tctctctccg 3601 tctctgtcgc tcttgtctgt ctgtctctgc tctttcctcg gcctctctcc ccagacctgg 3661 cccggccgcc ctgtctccgc aggctagatc cgaggtggca gctccagccc ccgggctcgc 3721 cccctcgcgg gcgtgccccg cgcgccccgg gcggccgaag gccgggccgc cccgtcccgc 3781 cccgtagttg ctctttcggt agtggcgatg cgccctgcat gtctcctcac ccgtggatcg 3841 tgacgactcg aaataacaga aacaaagtca ataaagtgaa aataaataaa aatccttgaa 3901 caaatccgaa aaggcttgga gtcctcgccc agatctctct cccctgcgag ccctttttat 3961 ttgagaagga aaaagagaaa agagaatcgt ttaagggaac ccggcgccca gccaggctcc 4021 agtggcccga acggggcggc gagggcggcg agggcgccga ggtccggccc atcccagtcc 4081 tgtggggctg gccgggcaga gaccccggac ccaggcccag gcctaacctg ctaaatgtcc 4141 ccggacggtt ctggtctcct cggccacttt cagtgcgtcg gttcgttttg attctttttc 4201 ttttgtgcac ataagaaata aataataata ataaataaag aataaaattt tgtatgtcaa 4261 aaaaaaaaaa aaaaaa Appendix C
LOCUS NM_000278 4207 bp mRNA linear PRI 24-SEP-2005 DEFINITION Homo sapiens paired box gene 2 (PAX2), transcript variant b, mRNA.
ACCESSION NM_000278 VERSION NM_000278.2 GI:34878700 KEYWORDS
SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Catarrhini;
Hominidae; Homo.
REFERENCE 1(bases 1 to 4207) AUTHORS Yoshimura,K., Yoshida,S., Yamaji,Y., Komori,A., Yoshida,A., Hatae,K., Kubota,T. and Ishibashi,T.
TITLE De novo insG619 mutation in PAX2 gene in a Japanese patient with papillorenal syndrome JOURNAL Am. J. Ophthalm:ol. 139 (4), 733-735 (2005) REMARK GeneRIF: Molecular genetic analysis of the PAX2 gene in combination with renal ultrasonography can help in making an earlier diagnosis of the disease.
REFERENCE 2 (bases 1 to 4207) AUTHORS Mazal,P.R., Stichenwirth,M., Koller,A., Blach,S., Haitel,A. and Susani,M.
TITLE Expression of aquaporins and PAX-2 compared to CD10 and cytokeratin 7 in renal neoplasms: a tissue microarray study JOURNAL Mod. Pathol. 18 (4), 535-540 (2005) RElVIARK GeneRIF: PAX-2 is a reliable marker for clear cell renal cell carcinomas of lower grades but not for higher grades.
REFERENCE 3 (bases 1 to 4207) AUTHORS Higashide,T., Wada,T., Sakurai,M., Yokoyama,H. and Sugiyama,K.
TITLE Macular abnormalities and optic disk anomaly associated with a new PAX2 missense mutation JOURNAL Am. J. Ophthalmol. 139 (1), 203-205 (2005) REMARK GeneRIF: A new PAX2 missense mutation, R71T, may cause macular abnormalities in addition to anomalies of the optic disk and the kidney.
REFERENCE 4 (bases 1 to 4207) AUTHORS Buttiglieri,S., Deregibus,M.C., Bravo,S., Cassoni,P., Chiarle,R., Bussolati,B. and Camussi,G.
TITLE Role of Pax2 in apoptosis resistance and proinvasive phenotype of Kaposi's sarcoma cells JOURNAL J. Biol. Chem. 279 (6), 4136-4143 (2004) REIVIARK GeneR.IF: expression of Pax2 by Kaposi's sarcoma cells correlated with an enhanced resistance against apoptotic signals and with the proinvasive phenotype REFERENCE 5 (bases 1 to 4207) AUTHORS Brophy,P.D., Lang,K.M. and Dressler,G.R.
TITLE The secreted frizzled related protein 2 (SFRP2) gene is a target of the Pax2 transcription factor JOURNAL J. Biol. Chem. 278 (52), 52401-52405 (2003) REMARK GeneRIF: Pax2 protein regulates expression of secreted frizzled related protein 2 REFERENCE 6 (bases 1 to 4207) AUTHORS Schimmenti,L.A., Manligas,G.S. and Sieving,P.A.
TITLE Optic nerve dysplasia and renal insufficiency in a family with a novel PAX2 mutation, Arg115X: further ophthalmologic delineation of the renal-coloboma syndrome JOURNAL Ophthalmic Genet. 24 (4), 191-202 (2003) REMARK GeneRIF: PAX2 mutation is associated with Optic nerve dysplasia and renal insufficiency of the renal-coloboma syndrome REFERENCE 7 (bases 1 to 4207) AUTHORS Muratovska,A., Zhou,C., He,S., Goodyer,P. and Eccles,M.R.
TITLE Paired-Box genes are frequently expressed in cancer and often required for cancer cell survival JOURNAL Oncogene 22 (39), 7989-7997 (2003) REMARK GeneRIF: The PAX2 gene was frequently expressed in a panel of 406 common primary tumor tissues and endogenous PAX gene expression is often required for the growth and survival of cancer cells REFERENCE 8 (bases 1 to 4207) AUTHORS Gough,S.M., McDonald,M., Chen,X.N., Korenberg,J.R., Neri,A., Kahn,T., Eccles,M.R. and Morris,C.M.
TITLE Refined physical map of the human PAX21HOX11/NFKB2 cancer gene region at 10q24 and relocalization of the HPV6AI1 viral integration site to 14q13.3-q21.1 JOURNAL BMC Genomics 4(1), (1),9 (2 REFERENCE 9 (bases 1 to 4207) AUTHORS Hoffineister,A., Ropolo,A., Vasseur,S., Mallo,G.V., Bodeker,H., Ritz-Laser,B., Dressler,G.R., Vaccaro,M.I., Dagorn,J.C., Moreno,S.
and Iovanna,J.L.
TITLE The HMG-UY-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter JOURNAL J. Biol. Chem. 277 (25), 22314-22319 (2002) RElVIARK GeneRIF: The HMG-I/Y-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter.
REFERENCE 10 (bases 1 to 4207) AUTHORS Cai,Y., Lechner,M.S., Nihalani,D., Prindle,M.J., Holzman,L.B. and Dressler,G.R.
TITLE Phosphorylation of Pax2 by the c-Jun N-terminal kinase and enhanced Pax2-dependent transcription activation JOURNAL J. Biol. Chem. 277 (2), 1217-1222 (2002) REFERENCE 11 (bases 1 to 4207) AUTHORS Becker,K., Beales,P.L., Calver,D.M., Matthijs,G. and Mohammed,S.N.
TITLE Okihiro syndrome and acro-renal-ocular syndrome: clinical overlap, expansion of the phenotype, and absence of PAX2 mutations in two new families JOURNAL J. Med. Genet. 39 (1), 68-71 (2002) REMARK GeneRIF: The absence of PAX2 mutations has been identified in two families with histories of clinical overlap of Okihiro and acro-renal-ocular syndromes.
REFERENCE 12 (bases 1 to 4207) AUTHORS Eccles,M.R., He,S., Legge,M., Kumar,R., Fox,J., Zhou,C., French,M.
and Tsai,R.W.
TITLE PAX genes in development and disease: the role of PAX2 in urogenital tract development JOURNAL Int. J. Dev. Biol. 46 (4), 535-544 (2002) REMARK Review article GeneRIF: PAX2 has a role in urogenital tract development and disease [review]
REFERENCE 13 (bases 1 to 4207) AUTHORS Chung,G.W., Edwards,A.O., Schimmenti,L.A., Manligas,G.S., Zhang,Y.H. and Ritter,R. III.
TITLE Renal-coloboma syndrome: report of a novel PAX2 gene mutation JOURNAL Am. J. Ophthalmol. 132 (6), 910-914 (2001) REIVIARK GeneRIF: The causal relationship between PAX2 gene mutations and renal-coloboma syndrome is further supported REFERENCE 14 (bases 1 to 4207) AUTHORS Nishimoto,K., Iijima,K., Shirakawa,T., Kitagawa,K., Satomura,K., Nakamura,H. and Yoshikawa,N.
TITLE PAX2 gene mutation in a family with isolated renal hypoplasia JOURNAL J. Am. Soc. Nephrol. 12 (8), 1769-1772 (2001) REFERENCE 15 (bases 1 to 4207) AUTHORS Ritz-Laser,B., Estreicher,A., Gauthier,B. and Philippe,J.
TITLE The paired homeodomain transcription factor Pax-2 is expressed in the endocrine pancreas and transactivates the glucagon gene promoter JOURNAL J. Biol. Chem. 275 (42), 32708-32715 (2000) REFERENCE 16 (bases 1 to 4207) AUTHORS Lechner,M.S., Levitan,I. and Dressler,G.R.
TITLE PTIP, a novel BRCT domain-containing protein interacts with Pax2 and is associated with active chromatin JOURNAL Nucleic Acids Res. 28 (14), 2741-2751 (2000) REFER.ENCE 17 (bases 1 to 4207) AUTHORS Tavassoli,K., Ruger,W. and Horst,J.
TITLE Alternative splicing in PAX2 generates a new reading frame and an extended conserved coding region at the carboxy terminus JOURNAL Hum. Genet. 101 (3), 371-375 (1997) REFERENCE 18 (bases 1 to 4207) AUTHORS Dahl,E., Koseki,H. and Balling,R.
TITLE Pax genes and organogenesis JOURNAL Bioessays 19 (9), 755-765 (1997) RElVIARK Review article REFERENCE 19 (bases 1 to 4207) AUTHORS Schimmenti,L.A., Cunliffe,H.E., McNoe,L.A., Ward,T.A., French,M.C., Shim,H.H., Zhang,Y.H., Proesmans,W., Leys,A., Byerly,K.A., Braddock,S.R., Masuno,M., Imaizumi,K., Devriendt,K. and Eccles,M.R.
TITLE Further delineation of renal-coloboma syndrome in patients with extreme variability of phenotype and identical PAX2 mutations JOURNAL Am. J. Hum. Genet. 60 (4), 869-878 (1997) REFERENCE 20 (bases 1 to 4207) AUTHORS Narahara,K., Baker,E., Ito,S., Yokoyama,Y., Yu,S., Hewitt,D., Sutherland,G.R., Eccles,M.R. and Richards,R.I.
TITLE Localisation of a l Oq breakpoint within the PAX2 gene in a patient with a de novo t(10;13) translocation and optic nerve coloboma-renal disease JOURNAL J. Med. Genet. 34 (3), 213-216 (1997) REFERENCE 21 (bases 1 to 4207) AUTHORS Dehbi,M., Ghahremani,M., Lechner,M., Dressler,G. and Pelletier,J.
TITLE The paired-box transcription factor, PAX2, positively modulates expression of the Wilms' tumor suppressor gene (WT1) JOURNAL Oncogene 13 (3), 447-453 (1996) REFERENCE 22 (bases 1 to 4207) AUTHORS Sanyanusin,P., Norrish,J.H., Ward,T.A., Nebel,A., McNoe,L.A. and Eccles,M.R.
TITLE Genomic structure of the human PAX2 gene JOURNAL Genomics 35 (1), 258-261 (1996) REFERENCE 23 (bases 1 to 4207) AUTHORS Sanyanusin,P., Schimmenti,L.A., McNoe,L.A., Ward,T.A., Pierpont,M.E., Sullivan,M.J., Dobyns,W.B. and Eccles,M.R.
TITLE Mutation of the PAX2 gene in a family with optic nerve colobomas, renal anomalies and vesicoureteral reflux JOURNAL Nat. Genet. 9 (4), 358-364 (1995) REFERENCE 24 (bases 1 to 4207) AUTHORS Ward,T.A., Nebel,A., Reeve,A.E. and Eccles,M.R.
TITLE Alternative messenger RNA forms and open reading frames within an additional conserved region of the human PAX-2 gene JOURNAL Cell Growth Differ. 5(9), 1015-1021 (1994) REFERENCE 25 (bases 1 to 4207) AUTHORS Noll,M.
TITLE Evolution and role of Pax genes JOURNAL Curr. Opin. Genet. Dev. 3 (4), 595-605 (1993) REMARK Review article REFERENCE 26 (bases 1 to 4207) AUTHORS Stapleton,P., Weith,A., Urbanek,P., Kozmik,Z. and Busslinger,M.
TITLE Chromosomal localization of seven PAX genes and cloning of a novel family member, PAX-9 JOURNAL Nat. Genet. 3(4), 292-298 (1993) REFERENCE 27 (bases 1 to 4207) AUTHORS Pilz,A.J., Povey,S., Gruss,P. and Abbott,C.M.
TITLE Mapping of the human homologs of the murine paired-box-containing genes JOURNAL Mamm. Genome 4(2), 78-82 (1993) REFERENCE 28 (bases 1 to 4207) AUTHORS Eccles,M.R., Wallis,L.J., Fidler,A.E., Spurr,N.K., Goodfellow,P.J.
and Reeve,A.E.
TITLE Expression of the PAX2 gene in human fetal kidney and Wilms' tumor JOURNAL Cell Growth Differ. 3 (5), 279-289 (1992) COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from U45255.1 and BM671839.1.
On Sep 22, 2003 this sequence version replaced gi:4557820.
Summary: PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1.
Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.
Transcript Variant: This variant (b) lacks an alternate in-frame exon and uses an alternate splice site in the 3' coding region, compared to variant e. This results in a protein (isoform b) with a shorter, distinct C-terminus compared to isoform e.
CQMPLETENESS: complete on the 3' end.
FEATURES Location/Qualifiers source 1..4207 /organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome=" 10"
/map=" 10q24"
gene 1..4207 /gene="PA.X2"
/db_xref-'-"GeneID:5076"
/db_~cre~"HGNC: 8616"
/db_xref="M]M:167409"
CDS 687..1868 /gene="PAX2"
/note="PAX2 gene is a member of the paired-box containing genes which encode transcription factors involved in embryonic and fetal development; the gene product is nuclear protein which binds DNA
isoform b is encoded by transcript variant b; paired box homeotic gene 2;
go_component: nucleus [goid 0005634] [evidence IEA];
go_function: ATP binding [goid 0005524] [evidence IEA];
go_function: DNA binding [goid 0003677] [evidence IEA];
go_function: DNA binding [goid 0003677] [evidence TAS]
[pmid 9106533];
go_function: nucleoside diphosphate kinase activity [goid 0004550] [evidence IEA];
go_process: development [goid 0007275] [evidence IEA];
go_process: transcription [goid 0006350] [evidence IEA];
go_process: CTP biosynthesis [goid 0006241] [evidence IEA];
go_process: GTP biosynthesis [goid 0006183] [evidence IEA];
go_process: UTP biosynthesis [goid 0006228] [evidence IEA];
go_process: axonogenesis [goid 0007409] [evidence TAS]
[pmid 9106533];
go_process: cell differentiation [goid 0030154] [evidence IEAJa go_process: visual perception [goid 0007601] [evidence TAS] [pmid 9106533];
go_process: regulation of transcription, DNA-dependent [goid 0006355] [evidence IEA];
go_process: transcription from RNA polymerase II promoter [goid 0006366] [evidence TAS] [pmid 8760285]"
/codon start=l /product="paired box protein 2 isoform b"
/protein id="NP_000269.2"
/db_xref--"GI:34878701 "
/dbxref--" GeneID:5076"
/dbxref--"HGNC:8616"
/db xref-'-"MIM:167409"
/translation="MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDV VRQRIVELAH
QGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVDKIAEYK
RQNPTMFAWEIRDRLLAEGICDNDTVPSVS SINRIIRTKVQQPFHPTPDGAGTGVTA
PGHTIVPSTASPPVS SASNDPVGSYSINGILGIPRSNGEKRKRDEDVSEGS VPNGDSQ
SGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTP
GLDEVKS SLSAS TNPELGSNV S GTQTYP V V TGRDMA.STTLPGYPPHVPPTGQGSYP
TSTLAGMVPGSEFS GNPYSHPQYTAYNEAWRFSNPALLS SPYYYSAAPRSAPAAAA
AAYDR
H"
STS 1857..2063 /gene="PAX2"
/standard name="RH80285"
/db_xref'--"UniSTS:88437"
STS 3055..3207 /gene="PAX2"
/standard_name="D 10S2478"
/db_xref="UniSTS :74159"
polyA_signal 4161..4166 /gene="PAX2"
polyA signal 4165..4170 /gene="PAX2" _ polyA_signal 4172..4177 /gene=TAX21' polyA_site 4190 /gene="PAX2"
ORIGIN
1 aggctccagt ctccggccga gtcttctcgc agccgcaacc cacctggggc cagcccagag 61 ctgccagcgc cgctcggctc cctccctccc tcccggccct tcggccgcgg cggcgtgcgc 121 ctgccttttc cgggggcggg ggcctggccc gcgcgctccc ctcccgcagg cgccacctcg 181 gacatccccg ggattgctac ttctctgcca acttcgccaa ctcgccagca cttggagagg 241 cccggctccc ctcccggcgc cctctgaccg cccccgcccc gcgcgctctc cgaccaccgc 301 ctctcggatg accaggttcc aggggagctg agcgagtcgc ctcccccgcc cagcttcagc 361 cctggctgca gctgcagcgc gagccatgcg cccccagtgc accccggccc ggcccaccgc 421 cccggggcca ttctgctgac cgcccagccc cgagccccga cagtggcaag ttgcggctac 481 tgcagttgca agctccggcc aacccggagg agccccagcg gggagcgcag tgttgcgccc 541 cccgcccccg cgcgccccgc agcagccggg cgttcactca tcctccctcc cccaccgtcc 601 ctcccttttc tcctcaagtc ctgaagttga gtttgagagg cgacacggcg gcggcggccg 661 cgctgctccc gctcctctgc ctccccatgg atatgcactg caaagcagac cccttctccg 721 cgatgcaccc agggcacggg ggtgtgaacc agctcggggg ggtgtttgtg aacggccggc 781 ccctacccga cgtggtgagg cagcgcatcg tggagctggc ccaccagggt gtgcggccct 841 gtgacatctc ccggcagctg cgggtcagcc acggctgtgt cagcaaaatc ctgggcaggt 901 actacgagac cggcagcatc aagccgggtg tgatcggtgg ctccaagccc aaagtggcga 961 cgcccaaagt ggtggacaag attgctgaat acaaacgaca gaacccgact atgttcgcct 1021 gggagattcg agaccggctc ctggccgagg gcatctgtga caatgacaca gtgcccagcg 1081 tctcttccat caacagaatc atccggacca aagttcagca gcctttccac ccaacgccgg 1141 atggggctgg gacaggagtg accgcccctg gccacaccat tgttcccagc acggcctccc 1201 ctcctgtttc cagcgcctcc aatgacccag tgggatccta ctccatcaat gggatcctgg 1261 ggattcctcg ctccaatggt gagaagagga aacgtgatga agatgtgtct gagggctcag 1321 tccccaatgg agattcccag agtggtgtgg acagtttgcg gaagcacttg cgagctgaca 1381 ccftcaccca gcagcagctg gaagctttgg atcgggtctt tgagcgtcct tcctaccctg 1441 acgtcttcca ggcatcagag cacatcaaat cagaacaggg gaacgagtac tccctcccag 1501 ccctgacccc tgggcttgat gaagtcaagt cgagtctatc tgcatccacc aaccctgagc 1561 tgggcagcaa cgtgtcaggc acacagacat acccagttgt gactggtcgt gacatggcga 1621 gcaccactct gcctggttac ccccctcacg tgccccccac tggccaggga agctacccca 1681 cctccaccct ggcaggaatg gtgcctggga gcgagttctc cggcaacccg tacagccacc 1741 cccagtacac ggcctacaac gaggcttgga gattcagcaa ccccgcctta ctaagttccc 1801 cttattatta tagtgccgcc ccccggtccg cccctgccgc tgctgccgct gcctatgacc 1861 gccactagtt accgcgggga ccacatcaag cttcaggccg acagcttcgg cctccacatc 1921 gtccccgtct gaccccaccc cggagggagg gaggaccgac gcgacgcgat gcctcccggc 1981 caccgcccca gcctcacccc atcccacgac ccccgcaacc cttcacatca cccccctcga 2041 aggtcggaca ggacgggtgg agccgtgggc gggaccctca ggcccgggcc cgccgccccc 2101 agccccgcct gccgcccctc cccgcctgcc tggactgcgc ggcgccgtga gggggattcg 2161 gcccagctcg tcccggcctc caccaagcca gccccgaagc ccgccagcca ccctgccgga 2221 ctcgggcgcg acctgctggc gcgcgccgga tgtttctgtg acacacaatc agcgcggacc 2281 gcagcgcggc ccagccccgg gcacccgcct cggacgctcg ggcgccagga ggcttcgctg 2341 gaggggctgg gccaaggaga ttaagaagaa aacgactttc tgcaggagga agagcccgct 2401 gccgaatccc tgggaaaaat tcttttcccc cagtgccagc cggactgccc tcgccttccg 2461 ggtgtgccct gtcccagaag atggaatggg ggtgtggggg tccggctcta ggaacgggct 2521 ttgggggcgt caggtctttc caaggttggg acccaaggat cggggggccc agcagcccgc 2581 accgatcgag ccggactctc ggctcttcac tgctcctcct ggcctgccta gttccccagg 2641 gcccggcacc tcctgctgcg agacccggct ctcagccctg ccttgcccct acctcagcgt 2701 ctcttccacc tgctggcctc ccagtttccc ctcctgccag tccttcgcct gtcccttgac 2761 gccctgcatc ctcctccctg actcgcagcc ccatcggacg ctctcccggg accgccgcag 2821 gaccagtttc catagactgc ggactggggt cttcctccag cagttacttg atgccccctc 2881 ccccgacaca gactctcaat ctgccggtgg taagaaccgg ttctgagctg gcgtctgagc 2941 tgctgcgggg tggaagtggg gggctgccca ctccactcct cccatcccct cccagcctcc 3001 tcctccggca ggaactgaac agaaccacaa aaagtctaca tttatttaat atgatggtct 3061 ttgcaaaaag gaacaaaaca acacaaaagc ccaccaggct gctgctttgt ggaaagacgg 3121 tgtgtgtcgt gtgaaggcga aacccggtgt acataacccc tccccctccg ccccgccccg 3181 cccggccccg tagagtccct gtcgcccgcc ggccctgcct gtagatacgc cccgctgtct 3241 gtgctgtgag agtcgccgct cgctgggggg gaaggggggg acacagctac acgcccatta 3301 aagcacagca cgtcctgggg gaggggggca ttttttatgt tacaaaaaaa aattacgaaa 3361 gaaaagaaat ctctatgcaa aatgacgaac atggtcctgt ggactcctct ggcctgtttt 3421 gttggctctt tctctgtaat tccgtgtttt cgctttttcc tccctgcccc tctctccctc 3481 tgcccctctc tcctctccgc ttctctcccc ctctgtctct gtctctctcc gtctctgtcg 3541 ctcttgtctg tctgtctctg ctctttcctc ggcctctctc cccagacctg gcccggccgc 3601 cctgtctccg caggctagat ccgaggtggc agctccagcc cccgggctcg ccccctcgcg 3661 ggcgtgcccc gcgcgccccg ggcggccgaa ggccgggccg ccccgtcccg ccccgtagtt 3721 gctctttcgg tagtggcgat gcgccctgca tgtctcctca cccgtggatc gtgacgactc 3781 gaaataacag aaacaaagtc aataaagtga aaataaataa aaatccttga acaaatccga 3841 aaaggcttgg agtcctcgcc cagatctctc tcccctgcga gcccttttta tttgagaagg 3901 aaaaagagaa aagagaatcg tttaagggaa cccggcgccc agccaggctc cagtggcccg 3961 aacggggcgg cgagggcggc gagggcgccg aggtccggcc catcccagtc ctgtggggct 4021 ggccgggcag agaccccgga cccaggccca ggcctaacct gctaaatgtc cccggacggt 4081 tctggtctcc tcggccactt tcagtgcgtc ggttcgtttt gattcttttt cttttgtgca 4141 cataagaaat aaataataat aataaataaa gaataaaatt ttgtatgtca aaaaaaaaaa 4201 aaaaaaa Appendix D
LOCUS NM_003988 4290 bp mRNA linear PRI 24-SEP-2005 DEFINITION Homo sapiens paired box gene 2 (PAX2), transcript variant c, mRNA.
ACCESSION NM_003988 VERSION NM003988.2 GI:34878708 KEYWORDS .
SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Catarrhini;
Hominidae; Homo.
REFERENCE 1 (bases 1 to 4290) AUTHORS Yoshimura,K., Yoshida,S., Yamaji,Y., Komori,A., Yoshida,A., Hatae,K., Kubota,T. and Ishibashi,T.
TITLE De novo insG6l9 mutation in PAX2 gene in a Japanese patient with papillorenal syndrome JOURNAL Am. J. Ophthalmol. 139 (4), 733-735 (2005) REMARK GeneRIF: Molecular genetic analysis of the PAX2 gene in combination with renal ultrasonography can help in making an earlier diagnosis of the disease.
REFERENCE 2 (bases 1 to 4290) AUTHORS Mazal,P.R., Stichenwirth,M., Koller,A., Blach,S., Haitel,A. and Susani,M.
TITLE Expression of aquaporins and PAX-2 compared to CD 10 and cytokeratin 7 in renal neoplasms: a tissue microarray study JOURNAL Mod. Pathol. 18 (4), 535-540 (2005) ' PUBMED 15502805 REIVIARK GeneRIF: PAX-2 is a reliable marker for clear cell renal cell carcinomas of lower grades but not for higher grades.
REFERENCE 3 (bases 1 to 4290) AUTHORS Higashide,T., Wada,T., Sakurai,M., Yokoyama,H. and Sugiyama,K.
TITLE Macular abnonnalities and optic disk anomaly associated with a new PAX2 missense mutation JOURNAL Am. J. Ophthalmol. 139 (1), 203-205 (2005) REMARK GeneRIF: A new PAX2 missense mutation, R71T, may cause macular abnormalities in addition to anomalies of the optic disk and the kidney.
REFERENCE 4 (bases 1 to 4290) AUTHORS Buttiglieri,S., Deregibus,M.C., Bravo,S., Cassoni,P., Chiarle,R., Bussolati,B. and Camussi,G.
TITLE Role of Pax2 in apoptosis resistance and proinvasive phenotype of Kaposi's sarcoma cells JOURNAL J. Biol. Chem. 279 (6), 4136-4143 (2004) REMARK GeneRIF: expression of Pax2 by Kaposi's sarcoma cells correlated with an enhanced resistance against apoptotic signals and with the proinvasive phenotype REFERENCE 5 (bases 1 to 4290) AUTHORS Brophy,P.D., Lang,K.M. and Dressler,G.R.
TITLE The secreted frizzled related protein 2 (SFRP2) gene is a target of the Pax2 transcription factor JOURNAL J. Biol. Chem. 278 (52), 52401-52405 (2003) REMARK GeneRIF: Pax2 protein regulates expression of secreted frizzled related protein 2 REFERENCE 6 (bases 1 to 4290) AUTHORS Schimmenti,L.A., Manligas,G.S. and Sieving,P.A.
TITLE Optic nerve dysplasia and renal insufficiency in a family with a novel PAX2 mutation, Argl 15X: further ophthalmologic delineation of the renal-coloboma syndrome JOURNAL Ophthalmic Genet. 24 (4), 191-202 (2003) REMARK GeneRIF: PAX2 mutation is associated with Optic nerve dysplasia and renal insufficiency of the renal-coloboma syndrome REFERENCE 7 (bases 1 to 4290) AUTHORS Muratovska,A., Zhou,C., He,S., Goodyer,P. and Eccles,M.R.
TITLE Paired-Box genes are frequently expressed in cancer and often required for cancer cell survival JOURNAL Oncogene 22 (39), 7989-7997 (2003) REMARK GeneRIF: The PAX2 gene was frequently expressed in a panel of 406 common primary tumor tissues and endogenous PAX gene expression is often required for the growth and survival of cancer cells REFERENCE 8 (bases 1 to 4290) AUTHORS Gough,S.M., McDonald,M., Chen,X.N., Korenberg,J.R., Neri,A., Kahn,T., Eccles,M.R. and Morris,C.M.
TITLE Refined physical map of the human PAX2/HOX11/NFKB2 cancer gene region at 10q24 and relocalization of the HPV6AI1 viral integration site to 14q13.3-q21.1 JOURNAL BMC Genomics 4(1), 9 (2003) REFERENCE 9(bases 1 to 4290) AUTHORS Hoffineister,A., Ropolo,A., Vasseur,S., Mallo,G.V., Bodeker,H., Ritz-Laser,B., Dressler,G.R., Vaccaro,M.I., Dagom,J.C., Moreno,S.
and Iovanna,J.L.
TITLE The HMG-I/Y-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter JOURNAL J. Biol. Chem. 277 (25), 22314-22319 (2002) RElVIARK GeneRIF: The HMG-UY-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter.
REFERENCE 10 (bases 1 to 4290) AUTHORS Cai,Y., Lechner,M.S., Nihalani,D., Prindle,M.J., Holzman,L.B. and Dressler,G.R.
TITLE Phosphorylation of Pax2 by the c-Jun N-terminal kinase and enhanced Pax2-dependent transcription activation JOURNAL J. Biol. Chem. 277 (2), 1217-1222 (2002) REFERENCE 11 (bases 1 to 4290) AUTHORS Becker,K., Beales,P.L., Calver,D.M., Matthijs,G. and Mohammed,S.N.
TITLE Okihiro syndrome and acro-renal-ocular syndrome: clinical overlap, expansion of the phenotype, and absence of PAX2 mutations in two new families JOURNAL J. Med. Genet. 39 (1), 68-71 (2002) REMARK GeneRIF: The absence of PAX2 mutations has been identified in two families with histories of clinical overlap of Okihiro and acro-renal-ocular syndromes.
REFERENCE 12 (bases 1 to 4290) AUTHORS Eccles,M.R., He,S., Legge,M., Kumar,R., Fox,.J., Zhou,C., French,M.
and Tsai,R.W.
TITLE PAX genes in development and disease: the role of PAX2 in urogenital tract development JOURNAL Int. J. Dev. Biol. 46 (4), 535-544 (2002) REMARK Review article GeneR1F: PAX2 has a role in urogenital tract development and disease [review]
REFERENCE 13 (bases 1 to 4290) AUTHORS Chung,G.W., Edwards,A.O., Schimmenti,L.A., Manligas,G.S., Zhang,Y.H. and Ritter,R. III.
TITLE Renal-coloboma syndrome: report of a novel PAX2 gene mutation JOURNAL Am. J. Ophthalmol. 132 (6), 910-914 (2001) RElV1ARK GeneRIF: The causal relationship between PAX2 gene mutations and renal-coloboma syndrome is fu.rther supported REFERENCE 14 (bases 1 to 4290) AUTHORS Nishimoto,K., Iijima,K., Shirakawa,T., Kitagawa,K., Satomura,K., Nakamura,H. and Yoshikawa,N.
TITLE PAX2 gene mutation in a family with isolated renal hypoplasia JOURNAL J. Am. Soc. Nephrol. 12 (8), 1769-1772 (2001) REFERENCE 15 (bases 1 to 4290) AUTHORS Ritz-Laser,B., Estreicher,A., Gauthier;B. and Philippe,J.
TITLE The paired homeodomain transcription factor Pax-2 is expressed in the endocrine pancreas and transactivates the glucagon gene promoter JOURNAL J. Biol. Chem. 275 (42), 32708-32715 (2000) REFERENCE 16 (bases 1 to 4290) AUTHORS Lechner,M.S., Levitan,I. and Dressler,G.R.
TITLE PTIP, a novel BRCT domain-containing protein interacts with Pax2 and is associated with active chromatin JOURNAL Nucleic Acids Res. 28 (14), 2741-2751 (2000) REFERENCE 17 (bases 1 to 4290) AUTHORS Tavassoli,K., Ruger,W. and Horst,J.
TITLE Alternative splicing in PAX2 generates a new reading frame and an extended conserved coding region at the carboxy terminus JOURNAL Hum. Genet. 101 (3), 371-375 (1997) REFERENCE 18 (bases 1 to 4290) AUTHORS Dahl,E., Koseki,H. and Balling,R.
TITLE Pax genes and organogenesis JOURNAL Bioessays 19 (9), 755-765 (1997) REIVIARK Review article REFERENCE 19 (bases 1 to 4290) AUTHORS Schimmenti,L.A., Cunliffe,H.E., McNoe,L.A., Ward,T.A., French,M.C., Shim,H.H., Zhang,Y.H., Proesmans,W., Leys,A., Byerly,K.A., Braddock,S.R., Masuno,M., Imaizumi,K., Devriendt,K. and Eccles,M.R.
TITLE Further delineation of renal-coloboma syndrome in patients with extreme variability of phenotype and identical PAX2 mutations JOURNAL Am. J. Hum. Genet. 60 (4), 869-878 (1997) REFERENCE 20 (bases 1 to 4290) AUTHORS Narahara,K., Baker,E., Ito,S., Yokoyama,Y., Yu,S., Hewitt,D., Sutherland,G.R., Eccles,M.R. and Richards,R.I.
TITLE Localisation of a 10q breakpoint within the PAX2 gene in a patient with a de novo t(10;13) translocation and optic nerve coloboma-renal disease JOURNAL J. Med. Genet. 34 (3), 213-216 (1997) REFERENCE 21 (bases 1 to 4290) AUTHORS Dehbi,M., Ghahremani,M., Lechner,M., Dressler,G. and Pelletier,J.
TITLE The paired-box transcription factor, PAX2, positively modulates expression of the Wilms' tumor suppressor gene (WT1) JOURNAL Oncogene 13 (3), 447-453 (1996) REFERENCE 22 (bases 1 to 4290) AUTHORS Sanyanusin,P., Norrish,J.H., Ward,T.A., Nebel,A., McNoe,L.A. and Eccles,M.R.
TITLE Genomic structure of the human PAX2 gene JOURNAL Genomics 35 (1), 258-261 (1996) REFERENCE 23 (bases 1 to 4290) AUTHORS Sanyanusin,P., Schimmenti,L.A., McNoe,L.A., Ward,T.A., Pierpont,M.E., Sullivan,M.J., Dobyns,W.B. and Eccles,M.R.
-- - -TITLE Mutation of the PAX2 gene in a family with optic nerve colobornas, renal anomalies and vesicoureteral reflux JOURNAL Nat. Genet. 9 (4), 358-364 (1995) REFERENCE 24 (bases 1 to 4290) AUTHORS Ward,T.A., Nebel,A., Reeve,A.E. and Eccles,M.R.
TITLE Alternative messenger RNA forms and open reading frames within an additional conserved region of the human PAX-2 gene JOURNAL Cell Growth Differ. 5(9), 1015-1021 (1994) REFERENCE 25 (bases 1 to 4290) AUTHORS Noll,M.
TITLE Evolution and role of Pax genes JOURNAL Curr. Opin. Genet. Dev. 3 (4), 595-605 (1993) REMARK Review article REFERENCE 26 (bases 1 to 4290) AUTHORS Stapleton,P., Weith,A., Urbanek,P., Kozmik,Z. and Busslinger,M.
TITLE Chromosomal localization of seven PAX genes and cloning of a novel family member, PAX-9 JOURNAL Nat. Genet. 3(4), 292-298 (1993) REFERENCE 27 (bases 1 to 4290) AUTHORS Pilz,A.J., Povey,S., Gruss,P. and Abbott,C.M..
TITLE Mapping of the human homologs of the murine paired-box-containing genes JOURNAL Mamm. Genome 4(2), 78-82 (1993) REFERENCE 28 (bases 1 to 4290) AUTHORS Eccles,M.R., Wallis,L.J., Fidler,A.E., Spurr,N.K., Goodfellow,P.J.
and Reeve,A.E.
TITLE Expression of the PAX2 gene in human fetal kidney and Wilms' tumor JOURNAL Cell Growth Differ. 3(5), 279-289 (1992) COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from U45255.1 and BM671839.1.
On Sep 22, 2003 this sequence version replaced gi:4557824.
Summary: PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT 1.
Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.
Transcript Variant: This variant (c) has multiple differences in the coding region, compared to variant e, one of which results in a translational frameshift. The resulting protein (isoform c) has a distinct C-terminus and is shorter than isoform e.
COMPLETENESS: complete on the 3' end.
FEATURES Location/Qualifiers source 1..4290 /organism="Homo sapiens"
/mol type="mRNA"
/dbxref--"taxon:9606"
/chromosome=" 10"
/map="10q24"
gene 1..4290 /gene="PAX2"
/db_xref--" GeneID: 5 076"
/db_xref--"HGNC:8616"
/db_xref'--"MIM:167409"
CDS 687..1877 /gene="PAX2"
/note="PAX2 gene is a member of the paired-box containing genes which encode transcription factors involved in embryonic and fetal development; the gene product is nuclear protein which binds DNA
isoform c is encoded by transcript variant c; paired box homeotic gene 2;
go_component: nucleus [goid 0005634] [evidence lEA];
go_function: ATP binding [goid 0005524] [evidence lEA];
go_function: DNA binding [goid 0003677] [evidence lEA];
go_function: DNA binding [goid 0003677] [evidence TAS]
[pmid 9106533];
go_function: nucleoside diphosphate kinase activity [goid 0004550] [evidence IEA];
go_process: development [goid 0007275] [evidence lEA];
go_process: transcription [goid 0006350] [evidence lEA];
go_process: CTP biosynthesis [goid 0006241] [evidence lEA];
go_process: GTP biosynthesis [goid 0006183] [evidence lEA];
go_process: UTP biosynthesis [goid 0006228] [evidence lEA];
go_process: axonogenesis [goid 0007409] [evidence TAS]
[pmid 9106533];
go_process: cell differentiation [goid 0030154] [evidence lEA];
go_process: visual perception [goid 0007601] [evidence TAS] [pmid 9106533];
go_process: regulation of transcription, DNA-dependent [goid 0006355] [evidence lEA];
go_process: transcription from RNA polymerase II promoter [goid 0006366] [evidence TAS] [pmid 8760285]"
/codon start=1 /product="paired box protein 2 isoform c"
/protein id="NP_003979.2"
/db_xref--" GI:348 78709"
/db_xref--"CCDS :CCDS7499.1"
/dbxref--"GeneID:5 076"
/dbxref--"HGNC:8616"
/db xref--"MIM:167409"
/translation="MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAH
QGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKV VDKIAEYK
RQNPTMFAWEIRDRLLAEGICDNDTVPS VS SINRIIRTKVQQPFHPTPDGAGTGVTA
PGHTIVPSTASPPVS SASNDPVGSYSINGILGII'RSNGEKR KR DEDVSEGSVPNGDSQ
SGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTP
GLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQGSYP
TSTLAGMVPEAAVGPS SSLMSKPGRKLAEVPPCVQPTGAS SPATRTATPSTRPTTRL
GDSA
TPPY"
STS 1940..2146 /gene="PAX2"
/standard_nam.e="RH80285"
/db_xref="Uni S TS : 8 843 7"
STS 3138..3290 /gene="PAX2"
/standardname="D 10S2478"
/db_xref="UniSTS:74159"
polyA_signal 4244..4249 /gene="PAX2"
polyA_signal 4248..4253 /gene="PAX2"
polyA_signal 4255..4260 /gene="PAX2"
polyA_site 4273 /gene="PAX2"
ORIGIN
1 aggctccagt ctccggccga gtcttctcgc agccgcaacc cacctggggc cagcccagag 61 ctgccagcgc cgctcggctc cctccctccc tcccggccct tcggccgcgg cggcgtgcgc 121 ctgccttttc cgggggcggg ggcctggccc gcgcgctccc ctcccgcagg cgccacctcg 181 gacatccccg ggattgctac ttctctgcca acttcgccaa ctcgccagca cttggagagg 241 cccggctccc ctcccggcgc cctctgaccg cccccgcccc gcgcgctctc cgaccaccgc 301 ctctcggatg accaggttcc aggggagctg agcgagtcgc ctcccccgcc cagcttcagc 361 cctggctgca gctgcagcgc gagccatgcg cccccagtgc accccggccc ggcccaccgc 421 cccggggcca ttctgctgac cgcccagccc cgagccccga cagtggcaag ttgcggctac 481 tgcagttgca agctccggcc aacccggagg agccccagcg gggagcgcag tgttgcgccc 541 cccgcccccg cgcgccccgc agcagccggg cgttcactca tcctccctcc cccaccgtcc 601 ctcccttttc tcctcaagtc ctgaagttga gtttgagagg cgacacggcg gcggcggccg 661 cgctgctccc gctcctctgc ctccccatgg atatgcactg caaagcagac cccttctccg 721 cgatgcaccc agggcacggg ggtgtgaacc agctcggggg ggtgtttgtg aacggccggc 781 ccctacccga cgtggtgagg cagcgcatcg tggagctggc ccaccagggt gtgcggccct 641 gtgacatctc ccggcagctg cgggtcagcc acggctgtgt cagcaaaatc ctgggcaggt 901 actacgagac cggcagcatc aagccgggtg tgatcggtgg ctccaagccc aaagtggcga 961 cgcccaaagt ggtggacaag attgctgaat acaaacgaca gaacccgact atgttcgcct 1021 gggagattcg agaccggctc ctggccgagg gcatctgtga caatgacaca gtgcccagcg 1081 tctcttccat caacagaatc atccggacca aagttcagca gcctttccac ccaacgccgg 1141 atggggctgg gacaggagtg accgcccctg gccacaccat tgttcccagc acggcctccc 1201 ctcctgtttc cagcgcctcc aatgacccag tgggatccta ctccatcaat gggatcctgg 1261 ggattcctcg ctccaatggt gagaagagga aacgtgatga agatgtgtct gagggctcag 1321 tccccaatgg agattcccag agtggtgtgg acagtttgcg gaagcacttg cgagctgaca 1381 ccttcaccca gcagcagctg gaagctttgg atcgggtctt tgagcgtcct tcctaccctg 1441 acgtcttcca ggcatcagag cacatcaaat cagaacaggg gaacgagtac tccctcccag 1501 ccctgacccc tgggcttgat gaagtcaagt cgagtctatc tgcatccacc aaccctgagc 1561 tgggcagcaa cgtgtcaggc acacagacat acccagttgt gactggtcgt gacatggcga 1621 gcaccactct gcctggttac ccccctcacg tgccccccac tggccaggga agctacccca 1681 cctccaccct ggcaggaatg gtgcctgagg ctgcagttgg tccctcatcc tccctcatga 1741 gcaagccggg gaggaagctt gcagaagtgc ccccttgtgt gcaacccact ggagcgagtt 1801 ctccggcaac ccgtacagcc acccccagta cacggcctac aacgaggctt ggagattcag 1861 caaccccgcc ttactaagtt ccccttatta ttatagtgcc gccccccggt ccgcccctgc 1921 cgctgctgcc gctgcctatg accgccacta gttaccgcgg ggaccacatc aagcttcagg 1981 ccgacagctt cggcctccac atcgtccccg tctgacccca ccccggaggg agggaggacc 2041 gacgcgacgc gatgcctccc ggccaccgcc ccagcctcac cccatcccac gacccccgca 2101 acccttcaca tcacccccct cgaaggtcgg acaggacggg tggagccgtg ggcgggaccc 2161 tcaggcccgg gcccgccgcc cccagccccg cctgccgccc ctccccgcct gcctggactg 2221 cgcggcgccg tgagggggat tcggcccagc tcgtcccggc ctccaccaag ccagccccga 2281 agcccgccag ccaccctgcc ggactcgggc gcgacctgct ggcgcgcgcc ggatgtttct 2341 gtgacacaca atcagcgcgg accgcagcgc ggcccagccc cgggcacccg cctcggacgc 2401 tcgggcgcca ggaggcttcg ctggaggggc tgggccaagg agattaagaa gaaaacgact 2461 ttctgcagga ggaagagccc gctgccgaat ccctgggaaa aattcttttc ccccagtgcc 2521 agccggactg ccctcgcctt ccgggtgtgc cctgtcccag aagatggaat gggggtgtgg 2581 gggtccggct ctaggaacgg gctttggggg cgtcaggtct ttccaaggtt gggacccaag 2641 gatcgggggg cccagcagcc cgcaccgatc gagccggact ctcggctctt cactgctcct 2701 cctggcctgc ctagttcccc agggcccggc acctcctgct gcgagacccg gctctcagcc 2761 ctgccttgcc cctacctcag cgtctcttcc acctgctggc ctcccagttt cccctcctgc 2821 cagtccttcg cctgtccctt gacgccctgc atcctcctcc ctgactcgca gccccatcgg 2881 acgctctccc gggaccgccg caggaccagt ttccatagac tgcggactgg ggtcttcctc 2941 cagcagttac ttgatgcccc ctcccccgac acagactctc aatctgccgg tggtaagaac 3001 cggttctgag ctggcgtctg agctgctgcg gggtggaagt ggggggctgc ccactccact 3061 cctcccatcc cctcccagcc tcctcctccg gcaggaactg aacagaacca caaaaagtct 3121 acatttattt aatatgatgg tctttgcaaa aaggaacaaa acaacacaaa agcccaccag 3181 gctgctgctt tgtggaaaga cggtgtgtgt cgtgtgaagg cgaaacccgg tgtacataac 3241 ccctccccct ccgccccgcc ccgcccggcc ccgtagagtc cctgtcgccc gccggccctg 3301 cctgtagata cgccccgctg tctgtgctgt gagagtcgcc gctcgctggg ggggaagggg 3361 gggacacagc tacacgccca ttaaagcaca gcacgtcctg ggggaggggg gcatttttta 3421 tgttacaaaa aaaaattacg aaagaaaaga aatctctatg caaaatgacg aacatggtcc 3481 tgtggactcc tctggcctgt tttgttggct ctttctctgt aattccgtgt tttcgctttt 3541 tcctccctgc ccctctctcc ctctgcccct ctctcctctc cgcttctctc cccctctgtc 3601 tctgtctctc tccgtctctg tcgctcttgt ctgtctgtct ctgctctttc ctcggcctct 3661 ctccccagac ctggcccggc cgccctgtct ccgcaggcta gatccgaggt ggcagctcca 3721 gcccccgggc tcgccccctc gcgggcgtgc cccgcgcgcc ccgggcggcc gaaggccggg 3781 ccgccccgtc ccgccccgta gttgctcttt cggtagtggc gatgcgccct gcatgtctcc 3841 tcacccgtgg atcgtgacga ctcgaaataa cagaaacaaa gtcaataaag tgaaaataaa 3901 taaaaatcct tgaacaaatc cgaaaaggct tggagtcctc gcccagatct ctctcccctg 3961 cgagcccttt ttatttgaga aggaaaaaga gaaaagagaa tcgtttaagg gaacccggcg 4021 cccagccagg ctccagtggc ccgaacgggg cggcgagggc ggcgagggcg ccgaggtccg 4081 gcccatccca gtcctgtggg gctggccggg cagagacccc ggacccaggc ccaggcctaa 4141 cctgctaaat gtccccggac ggttctggtc tcctcggcca ctttcagtgc gtcggttcgt 4201 tttgattctt tttcttttgt gcacataaga aataaataat aataataaat aaagaataaa 4261 attttgtatg tcaaaaaaaa aaaaaaaaaa Appendix E
LOCUS NM_003989 4188 bp inRNA linear PRI 24-SEP-2005 DEFINITION Homo sapiens paired box gene 2 (PAX2), transcript variant d, mRNA.
ACCESSION NM_003989 VERSION NM003989.2 GI:34878715 KEYWORDS .
SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Catarrhini;
Hominidae; Homo.
REFERENCE 1 (bases 1 to 4188) AUTHORS Yoshimura,K., Yoshida,S., Yamaji,Y., Komori,A., Yoshida,A., Hatae,K., Kubota,T. and Ishibashi,T.
TITLE De novo insG6l9 mutation in PAX2 gene in a Japanese patient with papillorenal syndrome JOURNAL Am. J. Ophthalmol. 139 (4), 733-735 (2005) RElV1ARK GeneRIF: Molecular genetic analysis of the PAX2 gene in combination with renal ultrasonography can help in making an earlier diagnosis of the disease.
REFERENCE 2 (bases i to 4188) AUTHORS Mazal,P.R., Stichenwirth,M., Koller,A., Blach,S., Haitel,A. and Susani,M.
TITLE Expression of aquaporins and PAX-2 compared to CD10 and cytokeratin 7 in renal neoplasms: a tissue microarray study JOURNAL Mod. Pathol. 18 (4), 535-540 (2005) REMARK GeneRIF: PAX-2 is a reliable marker for clear cell renal cell carcinomas of lower grades but not for higher grades.
REFERENCE 3 (bases 1 to 4188) AUTHORS Higashide,T., Wada,T., Sakurai,M., Yokoyama,H. and Sugiyama,K.
TITLE Macular abnormalities and optic disk anomaly associated with a new PAX2 missense mutation JOURNAL Am. J. Ophthalmol. 139 (1), 203-205 (2005) REMARK GeneRIF: A new PAX2 missense mutation, R71T, may cause macular abnormalities in addition to anomalies of the optic disk and the kidney.
REFERENCE 4 (bases 1 to 4188) AUTHORS Buttiglieri,S., Deregibus,M.C., Bravo,S., Cassoni,P., Chiarle,R., Bussolati,B. and Camussi,G.
TITLE Role of Pax2 in apoptosis resistance and proinvasive phenotype of Kaposi's sarcoma cells JOURNAL J. Biol. Chem. 279 (6), 4136-4143 (2004) REMARK GeneRIF: expression of Pax2 by Kaposi's sarcoma cells correlated with an enhanced resistance against apoptotic signals and with the proinvasive phenotype REFERENCE 5 (bases 1 to 4188) AUTHORS Brophy,P.D., Lang,K.M. and Dressler,G.R.
TITLE The secreted frizzled related protein 2 (SFRP2) gene is a target of the Pax2 transcription factor JOURNAL J. Biol. Chem. 278 (52), 52401-52405 (2003) REMARK GeneRIF: Pax2 protein regulates expression of secreted frizzled related protein 2 REFERENCE 6 (bases 1 to 4188) AUTHORS Schimmenti,L.A., Manligas,G.S. and Sieving,P.A.
TITLE Optic nerve dysplasia and renal insufficiency in a family with a novel PAX2 mutation, Argl 15X: further ophthalmologic delineation of the renal-coloboma syndrome JOURNAL Ophthalmic Genet. 24 (4), 191-202 (2003) REMARK GeneRIF: PAX2 mutation is associated with Optic nerve dysplasia and renal insufficiency of the renal-coloboma syndrome REFERENCE 7 (bases 1 to 4188) AUTHORS Muratovska,A., Zhou,C., He,S., Goodyer,P. and Eccles,M.R.
TITLE Paired-Box genes are frequently expressed in cancer and often required for cancer cell survival JOURNAL Oncogene 22 (39), 7989-7997 (2003) REMARK GeneRIF: The PAX2 gene was frequently expressed in a panel of 406 common primary tumor tissues and endogenous PAX gene expression is often required for the growth and survival of cancer cells REFERENCE 8 (bases 1 to 4188) AUTHORS Gough,S.M., McDonald,M., Chen,X.N., Korenberg,J.R., Neri,A., Kahn,T., Eccles,M.R. and Morris,C.M.
TITLE Refined physical map of the human PAX2/HOX11/NFKB2 cancer gene region at 10q24 and relocalization of the HPV6AI1 viral integration site to 14q13.3-q21.1 JOURNAL BMC Genomics 4(1), (1),9 (2 REFERENCE 9 (bases 1 to 4188) AUTHORS Hoffineister,A., Ropolo,A., Vasseur,S., Mallo,G.V., Bodeker,H., Ritz-Laser,B., Dressler,G.R., Vaccaro,M.I., Dagorn,J.C., Moreno,S.
and Iovanna,J.L.
TITLE The HMG-I/Y-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter JOURNAL J. Biol. Chem. 277 (25), 22314-22319 (2002) REMARK GeneRIF: The HMG-I/Y-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter.
REFERENCE 10 (bases 1 to 4188) AUTHORS Cai,Y., Lechner,M.S., Nihalani,D., Prindle,M.J., Holzman,L.B. and Dressler,G.R.
TITLE Phosphorylation of Pax2 by the c-Jun N-terminal kinase and enhanced Pax2-dependent transcription activation JOURNAL J. Biol. Chem. 277 (2), 1217-1222 (2002) REFERENCE 11 (bases 1 to 4188) AUTHORS Becker,K., Beales,P.L., Calver,D.M., Matthijs,G. and Mohammed,S.N.
TITLE Okihiro syndrome and acro-renal-ocular syndrome: clinical overlap, expansion of the phenotype, and absence of PAX2 mutations in two new families JOURNAL J. Med. Genet. 39 (1), 68-71 (2002) REMARK GeneRIF: The absence of PAX2 mutations has been identified in two families with histories of clinical overlap of Okihiro and acro-renal-ocular syndromes.
REFERENCE 12 (bases 1 to 4188) AUTHORS. Eccles,M.R., He,S., Legge,M., Kumar,R., Fox,J., Zhou,C., French,M.
and Tsai,R.W.
TITLE PAX genes in development and disease: the role of PAX2 in urogenital tract development JOURNAL Int. J. Dev. Biol. 46 (4), 535-544 (2002) REMARK Review article GeneRIF: PAX2 has a role in urogenital tract development and disease [review]
REFERENCE 13 (bases 1 to 4188) AUTHORS Chung,G.W., Edwards,A.O., Schimmenti,L.A., Manligas,G.S., Zhang,Y.H. and Ritter,R. III.
TITLE Renal-c,oloboma syndrome: report of a novel PAX2 gene mutation JOURNAL Am. J. Ophthalmol. 132 (6), 910-914 (2001) RElVIARK GeneRIF: The causal relationship between PAX2 gene mutations and renal-coloboma syndrome is fiirther supported REFERENCE 14 (bases 1 to 4188) AUTHORS Nishimoto,K., Iijima,K., Shirakawa,T., Kitagawa,K., Satomura,K., Nakamura,H. and Yoshikawa,N.
TITLE PAX2 gene mutation in a family with isolated renal hypoplasia JOURNAL J. Am. Soc. Nephrol. 12 (8), 1769-1772 (2001) REFERENCE 15 (bases 1 to 4188) AUTHORS Ritz-Laser,B., Estreicher,A., Gauthier;B. and Philippe,J.
TITLE The paired homeodomain transcription factor Pax-2 is expressed in the endocrine pancreas and transactivates the glucagon gene promoter JOURNAL J. Biol. Chem. 275 (42), 32708-32715 (2000) REFERENCE 16 (bases 1 to 4188) AUTHORS Lechner,M.S., Levitan,I. and Dressler,G.R.
TITLE PTIP, a novel BRCT domain-containing protein interacts with Pax2 and is associated with active chromatin JOURNAL Nucleic Acids Res. 28 (14), 2741-2751 (2000) REFERENCE 17 (bases 1 to 4188) AUTHORS Tavassoli,K., Ruger,W. and Horst,J.
TITLE Alternative splicing in PAX2 generates a new reading frame and an extended conserved coding region at the carboxy terminus JOURNAL Hum. Genet. 101 (3), 371-375 (1997) REFERENCE 18 (bases 1 to 4188) AUTHORS Dahl,E., Koseki,H. and Balling,R.
TITLE Pax genes and organogenesis JOURNAL Bioessays 19 (9), 755-765 (1997) REMARK Review article REFERENCE 19 (bases 1 to 4188) AUTHORS Schimmenti,L.A., Cunliffe,H.E., McNoe,L.A., Ward,T.A., French,M.C., Shim,H.H., Zhang,Y.H., Proesmans,W., Leys,A., Byerly,K.A., Braddock,S.R., Masuno,M., Imaizumi,K., Devriendt,K. and Eccles,M.R.
TITLE Further delineation of renal-coloboma syndrome in patients with extreme variability of phenotype and identical PAX2 mutations JOURNAL Am. J. Hum. Genet. 60 (4), 869-878 (1997) REFERENCE 20 (bases 1 to 4188) AUTHORS Narahara,K., Baker,E., Ito,S., Yokoyama,Y., Yu,S., Hewitt,D., Sutherland,G.R., Eccles,M.R. and Richards,R.I.
TITLE Localisation of a l Oq breakpoint within the PAX2 gene in a patient with a de novo t(10;13) translocation and optic nerve coloboma-renal disease JOURNAL J. Med. Genet. 34 (3), 213-216 (1997) REFERENCE 21 (bases 1 to 4188) AUTHORS Dehbi,M., Ghahremani,M., Lechner,M., Dressler,G. and Pelletier,J.
TITLE The paired-box transcription factor, PAX2, positively modulates expression of the Wilms' tumor suppressor gene (WT1) JOURNAL Oncogene 13 (3), 447-453 (1996) REFERENCE 22 (bases 1 to 4188) AUTHORS Sanyanusin,P., Norrish,J.H., Ward,T.A., Nebel,A., McNoe,L.A. and Eccles,M.R.
TITLE Genomic structure of the human PAX2 gene JOURNAL Genomics 35 (1), 258-261 (1996) REFERENCE 23 (bases 1 to 4188) AUTHORS Sanyanusin,P., Schimmenti,L.A., McNoe,L.A., Ward,T.A., Pierpont,M.E., Sullivan,M.J., Dobyns,W.B. and Eccles,M.R.
TITLE Mutation of the PAX2 gene in a family with optic nerve colobomas, renal anomalies and vesicoureteral reflux JOURNAL Nat. Genet. 9(4), 358-364 (1995) REFERENCE 24 (bases 1 to 4188) AUTHORS Ward,T.A., Nebel,A., Reeve,A.E. and Eccles,M.R.
TITLE Alternative messenger RNA forms and open reading frames within an additional conserved region of the human PAX-2 gene JOURNAL Cell Growth Differ. 5(9), 1015-1021 (1994) REFERENCE 25 (bases 1 to 4188) AUTHORS Noll,M.
TITLE Evolution and role of Pax genes JOURNAL Curr. Opin. Genet. Dev. 3 (4), 595-605 (1993) REMARK Review article REFERENCE 26 (bases 1 to 4188) AUTHORS Stapleton,P., Weith,A., Urbanek,P., Kozmik,Z. and Busslinger,M.
TITLE Chromosomal localization of seven PAX genes and cloning of a novel family member, PAX-9 JOURNAL Nat. Genet. 3(4), 292-298 (1993) REFERENCE 27 (bases 1 to 4188) AUTHORS Pilz,A.J., Povey,S., Gruss,P. and Abbott,C.M.
TITLE Mapping of the human homologs of the murine paired-box-containing genes JOURNAL Mamm. Genome 4(2), 78-82 (1993) REFERENCE 28 (bases 1 to 4188) AUTHORS Eccles,M.R., Wallis,L.J., Fidler,A.E., Spurr,N.K., Goodfellow,P.J.
and Reeve,A.E.
TITLE Expression of the PAX2 gene in human fetal kidney and Wilms' tumor JOURNAL Cell Growth Differ. 3(5), 279-289 (1992) COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from U45255.1 and BM671839.1.
On Sep 22, 2003 this sequence version replaced gi:4557826.
Summary: PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1.
Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.
Transcript Variant: This variant (d) lacks an alternate in-frame exon compared to variant e. This results in an isoform (isoform d) that is shorter than isoform e.
COMPLETENESS: complete on the 3' end.
FEATURES Location/Qualifiers source 1..4188 /organism="Homo sapiens"
/mol_type="mRNA"
/db_xref-"taxon: 9606"
/chromosome=" 10"
/map=" 10q24"
gene 1..4188 /gene="PAX2"
/db_xref "GeneID:5076"
/dbxref-'HGNC:8616"
/db_xref--"HPRD:HPRD_01330"
/db_xref-"MIM:167409"
CDS 687..1913 /gene="PAX2"
/note="PAX2 gene is a member of the paired-box containing genes which encode transcription factors involved in embryonic and fetal development; the gene product is nuclear protein which binds DNA
isoform d is encoded by transcript variant d; paired box homeotic gene 2;
go_component: nucleus [goid 0005634] [evidence IEA];
go_function: ATP binding [goid 0005524] [evidence IEA];
go_function: DNA binding [goid 0003677] [evidence IEA];
go_function: DNA binding [goid 0003677] [evidence TAS]
[pmid 9106533];
go_fiinction: nucleoside diphosphate kinase activity [goid 0004550] [evidence IEA];
go_process: development [goid 0007275] [evidence IEA];
go_process: transcription [goid 0006350] [evidence IEA];
go_process: CTP biosynthesis [goid 0006241] [evidence IEA];
go_process: GTP biosynthesis [goid 0006183] [evidence IEA];
go_process: UTP biosynthesis [goid 0006228] [evidence IEA];
go_process: axonogenesis [goid 0007409] [evidence TAS]
[pmid 9106533];
go_process: cell differentiation [goid 0030154] [evidence IEA];
go_process: visual perception [goid 0007601] [evidence TAS] [pmid 9106533];
go_process: regulation of transcription, DNA-dependent [goid 0006355] [evidence IEA];
go-process: transcription from RNA polymerase II promoter [goid 0006366] [evidence TAS] [pmid 8760285]"
/codon start=1 /product="paired box protein 2 isoform d"
/protein id="NP_003980.2"
/dbxref--"GI:34878716"
/dbxref--" GeneID: 5 076"
/db_xref--"HGNC:8616"
/db_xre f--"HPRD : HPRD_013 3 0"
/db xref--"MIM:167409"
/translation="MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPD V VRQRIVELAH
QGVRPCDISRQLRV SHGCV SKILGRYYETGS IKP GV IGGSKPKVATPKV VDKIAEYK
RQNPTMFAWEIRDRLLAEGICDNDTVPS VSSINRIIRTKVQQPFHPTPDGAGTGVTA
PGHTIVPSTASPPV S SASNDPV GSYSINGILGIPRSNGEKR KR DEDV SEGS VPNGD S Q
SGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTP
GLDEVKS SLSASTNPELGSNV S GTQTYPV VTGRDMASTTLPGYPPHVPPTGQGSYP
TSTLAGMVPGSEFS GNPYSHPQYTAYNEAWRFSNPALLMPPPGPPLPLLPLPMTATS
YRGDHIKLQAD SFGLHIVP V"
STS 1838..2044 /gene="PAX2"
/standard_name="RH80285"
/db_xref--"Uni S T S: 8 843 7"
STS 3036..3188 /gene="PAX2"
/standard name="Dl0S2478"
/db_xref="Uni S T S: 7415 9"
polyA_signal 4142..4147 /gene="PAX2"
polyA_signal 4146..4151 /gene="PAX2"
p o lyA_s i gnal 415 3..415 8 /gene="PAX2"
polyAAsite 4171 /gene="PAX2"
ORIGIN
1 aggctccagt ctccggccga gtcttctcgc agccgcaacc cacctggggc cagcccagag 61 ctgccagcgc cgctcggctc cctccctccc tcccggccct tcggccgcgg cggcgtgcgc 121 ctgccttttc cgggggcggg ggcctggccc gcgcgctccc ctcccgcagg cgccacctcg 181 gacatccccg ggattgctac ttctctgcca acttcgccaa ctcgccagca cttggagagg 241 cccggctccc ctcccggcgc cctctgaccg cccccgcccc gcgcgctctc cgaccaccgc 301 ctctcggatg accaggttcc aggggagctg agcgagtcgc ctcccccgcc cagcttcagc 361 cctggctgca gctgcagcgc gagccatgcg cccccagtgc accccggccc ggcccaccgc 421 cccggggcca ttctgctgac cgcccagccc cgagccccga cagtggcaag ttgcggctac 481 tgcagttgca agctccggcc aacccggagg agccccagcg gggagcgcag tgttgcgccc 541 cccgcccccg cgcgccccgc agcagccggg cgttcactca tcctccctcc cccaccgtcc 601 ctcccttttc tcctcaagtc ctgaagttga gtttgagagg cgacacggcg gcggcggccg 661 cgctgctccc gctcctctgc ctccccatgg atatgcactg caaagcagac cccttctccg 721 cgatgcaccc agggcacggg ggtgtgaacc agctcggggg ggtgtttgtg aacggccggc 781 ccctacccga cgtggtgagg cagcgcatcg tggagctggc ccaccagggt gtgcggccct 841 gtgacatctc ccggcagctg cgggtcagcc acggctgtgt cagcaaaatc ctgggcaggt 901 actacgagac cggcagcatc aagccgggtg tgatcggtgg ctccaagccc aaagtggcga 961 cgcccaaagt ggtggacaag attgctgaat acaaacgaca gaacccgact atgttcgcct 1021 gggagattcg agaccggctc ctggccgagg gcatctgtga caatgacaca gtgcccagcg 1081 tctcttccat caacagaatc atccggacca aagttcagca gcctttccac ccaacgccgg 1141 atggggctgg gacaggagtg accgcccctg gccacaccat tgttcccagc acggcctccc 1201 ctcctgtttc cagcgcctcc aatgacccag tgggatccta ctccatcaat gggatcctgg 1261 ggattcctcg ctccaatggt gagaagagga aacgtgatga agatgtgtct gagggctcag 1321 tccccaatgg agattcccag agtggtgtgg acagtttgcg gaagcacttg cgagctgaca 1381 ccttcaccca gcagcagctg gaagctttgg atcgggtctt tgagcgtcct tcctaccctg 1441 acgtcttcca ggcatcagag cacatcaaat cagaacaggg gaacgagtac tccctcccag 1501 ccctgacccc tgggcttgat gaagtcaagt cgagtctatc tgcatccacc aaccctgagc 1561 tgggcagcaa cgtgtcaggc acacagacat acccagttgt gactggtcgt gacatggcga 1621 gcaccactct gcctggttac ccccctcacg tgccccccac tggccaggga agctacccca 1681 cctccaccct ggcaggaatg gtgcctggga gcgagttctc cggcaacccg tacagccacc 1741 cccagtacac ggcctacaac gaggcttgga gattcagcaa ccccgcctta ctaatgccgc 1801 cccccggtcc gcccctgccg ctgctgccgc tgcctatgac cgccactagt taccgcgggg 1861 accacatcaa gcttcaggcc gacagcttcg gcctccacat cgtccccgtc tgaccccacc 1921 ccggagggag ggaggaccga cgcgacgcga tgcctcccgg ccaccgcccc agcctcaccc 1981 catcccacga cccccgcaac ccttcacatc acccccctcg aaggtcggac aggacgggtg 2041 gagccgtggg cgggaccctc aggcccgggc ccgccgcccc cagccccgcc tgccgcccct 2101 ccccgcctgc ctggactgcg cggcgccgtg agggggattc ggcccagctc gtcccggcct 2161 ccaccaagcc agccccgaag cccgccagcc accctgccgg actcgggcgc gacctgctgg 2221 cgcgcgccgg atgtttctgt gacacacaat cagcgcggac cgcagcgcgg cccagccccg 2281 ggcacccgcc tcggacgctc gggcgccagg aggcttcgct ggaggggctg ggccaaggag 2341 attaagaaga aaacgacttt ctgcaggagg aagagcccgc tgccgaatcc ctgggaaaaa 2401 ttcttttccc ccagtgccag ccggactgcc ctcgccttcc gggtgtgccc tgtcccagaa 2461 gatggaatgg gggtgtgggg gtccggctct aggaacgggc tttgggggcg tcaggtcttt 2521 ccaaggttgg gacccaagga tcggggggcc cagcagcccg caccgatcga gccggactct 2581 cggctcttca ctgctcctcc tggcctgcct agttccccag ggcccggcac ctcctgctgc 2641 gagacccggc tctcagccct gccttgcccc tacctcagcg tctcttccac ctgctggcct 2701 ccoagtttcc cctcctgcca gtccttcgcc tgtcccttga cgccctgcat cctcctccct 2761 gactcgcagc cccatcggac gctctcccgg gaccgccgca ggaccagttt ccatagactg 2821 cggactgggg tcttcctcca gcagttactt gatgccccct cccccgacac agactctcaa 2881 tctgccggtg gtaagaaccg gttctgagct ggcgtctgag ctgctgcggg gtggaagtgg 2941 ggggctgccc actccactcc tcccatcccc tcccagcctc ctcctccggc aggaactgaa 3001 cagaaccaca aaaagtctac atttatttaa tatgatggtc tttgcaaaaa ggaacaaaac 3061 aacacaaaag cccaccaggc tgctgctttg tggaaagacg gtgtgtgtcg tgtgaaggcg 3121 aaacccggtg tacataaccc ctccccctcc gccccgcccc gcccggcccc gtagagtccc 3181 tgtcgcccgc cggccctgcc tgtagatacg ccccgctgtc tgtgctgtga gagtcgccgc 3241 tcgctggggg ggaagggggg gacacagcta cacgcccatt aaagcacagc acgtcctggg 3301 ggaggggggc attttttatg ttacaaaaaa aaattacgaa agaaaagaaa tctctatgca 3361 aaatgacgaa catggtcctg tggactcctc tggcctgttt tgttggctct ttctctgtaa 3421 ttccgtgttt tcgctttttc ctccctgccc ctctctccct ctgcccctct ctcctctccg 3481 cttctctccc cctctgtctc tgtctctctc cgtctctgtc gctcttgtct gtctgtctct 3541 gctctttcct cggcctctct ccccagacct ggcccggccg ccctgtctcc gcaggctaga 3601 tccgaggtgg cagctccagc ccccgggctc gccccctcgc gggcgtgccc cgcgcgcccc 3661 gggcggccga aggccgggcc gccccgtccc gccccgtagt tgctctttcg gtagtggcga 3721 tgcgccctgc atgtctcctc acccgtggat cgtgacgact cgaaataaca gaaacaaagt 3781 caataaagtg aaaataaata aaaatccttg aacaaatccg aaaaggcttg gagtcctcgc 3841 ccagatctct ctcccctgcg agcccttttt atttgagaag gaaaaagaga aaagagaatc 3901 gtttaaggga acccggcgcc cagccaggct ccagtggccc gaacggggcg gcgagggcgg 3961 cgagggcgcc gaggtccggc ccatcccagt cctgtggggc tggccgggca gagaccccgg 4021 acccaggccc aggcctaacc tgctaaatgt ccccggacgg ttctggtctc ctcggccact 4081 ttcagtgcgt cggttcgttt tgattctttt tcttttgtgc acataagaaa taaataataa 4141 taataaataa agaataaaat tttgtatgtc aaaaaaaaaa aaaaaaaa APPENDIX F
LOCUS NM_003990 4257 bp mRNA linear PRI 24-SEP-2005 DEFINITION Homo sapiens paired box gene 2 (PAX2), transcript variant e, mRNA.
VERSION NM_003990.2 GI:34878702 KEYWORDS
SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; 'Vertebrata; Euteleostomi;
Manimalia; Eutheria; Euarchontoglires; Primates; Catarrhini;
Hominidae; Homo.
REFERENCE 1 (bases 1 to 4257) AUTHORS Yoshimura,K., Yoshida,S., Yamaji,Y., Komori,A., Yoshida,A., Hatae,K., Kubota,T. and Ishibashi,T.
TITLE De novo insG619 mutation in PAX2 gene in a Japanese patient with papillorenal syndrome JOURNAL Am. J. Ophthalmol. 139 (4), 733-735 (2005) REMARK GeneRIF: Molecular genetic analysis of the PAX2 gene in combination with renal ultrasonography can help in making an earlier diagnosis of the disease.
REFERENCE 2 (bases 1 to 4257) AUTHORS Mazal,P.R., Stichenwirth,M., Ko11er,A., Blach,S., Haitel,A. and Susani,M.
TITLE Expression of aquaporins and PAX-2 compared to CD10 and cytokeratin 7 in renal neoplasms: a tissue microarray study JOURNAL Mod. Pathol. 18 (4), 535-540 (2005) REMARK GeneRIF: PAX-2 is a reliable marker for clear cell renal cell carcinomas of lower grades but not for higher grades.
REFERENCE 3 (bases 1 to 4257) AUTHORS Higashide,T., Wada,T., Sakurai,M., Yokoyama,H. and Sugiyama,K.
TITLE Macular abnormalities and optic disk anomaly associated with a new PAX2 missense mutation JOURNAL Am. J. Ophthalmol. 139 (1), 203-205 (2005) REMARK GeneRIF: A new PAX2 missense mutation, R71T, may cause macular abnormalities in addition to anomalies of the optic disk and the kidney.
REFERENCE 4 (bases 1 to 4257) AUTHORS Buttiglieri,S., Deregibus,M.C., Bravo,S., Cassoni,P., Chiarle,R., Bussolati,B. and Camussi,G.
TITLE Role of Pax2 in apoptosis resistance and proinvasive phenotype of Kaposi's sarcoma cells JOURNAL J. Biol. Chem. 279 (6), 4136-4143 (2004) REMARK GeneRIF: expression of Pax2 by Kaposi's sarcoma cells correlated with an enhanced resistance against apoptotic signals and with the proinvasive phenotype REFERENCE 5 (bases 1 to 4257) AUTHORS Brophy,P.D., Lang,K.M. and Dressler,G.R.
TITLE The secreted frizzled related protein 2 (SFRP2) gene is a target of the Pax2 transcription factor JOURNAL J. Biol. Chem. 278 (52), 52401-52405 (2003) REMARK GeneRIF: Pax2 protein regulates expression of secreted frizzled related protein 2 REFERENCE 6 (bases 1 to 4257) AUTHORS Schimmenti,L.A., Manligas,G.S. and Sieving,P.A.
TITLE Optic nerve dysplasia and renal insufficiency in a family with a novel PAX2 mutation, Arg115X: further ophthahnologic delineation of the renal-coloboma syndrome JOURNAL Ophthalmic Genet. 24 (4), 191-202 (2003) REMARK GeneRIF: PAX2 mutation is associated with Optic nerve dysplasia and renal insufficiency of the renal-coloboma syndrome REFERENCE 7 (bases 1 to 4257) AUTHORS Muratovska,A., Zhou,C., He,S., Goodyer,P. and Eccles,M.R.
TITLE Paired-Box genes are frequently expressed in cancer and often required for cancer cell survival JOURNAL Oncogene 22 (39), 7989-7997 (2003) REIVIARK. GeneRIF: The PAX2 gene was frequently expressed in a panel of 406 common primary tumor tissues and endogenous PAX gene expression is often required for the growth and survival of cancer cells REFERENCE 8 (bases 1 to 4257) AUTHORS Gough,S.M., McDonald,M., Chen,X.N., Korenberg,J.R., Neri,A., Kahn,T., Eccles,M.R. and Morris,C.M.
TITLE Refined physical map of the human PAX2/HOX11/NFKB2 cancer gene region at 10q24 and relocalization of the HPV6AI1 viral integration site to 14q13.3-q21.1 JOURNAL BMC Genomics 4(1), (1),9 (2 REFERENCE 9(bases 1 to 4257) AUTHORS Hoffineister,A., Ropolo,A., Vasseur,S., Mallo,G.V., Bodeker,H., Ritz-Laser,B., Dressler,G.R., Vaccaro,M.I., Dagorn,J.C., Moreno,S.
and Iovanna,J.L.
TITLE The HMG-UY-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter JOURNAL J. Biol. Chem. 277 (25), 22314-22319 (2002) REMARK GeneRIF: The HMG-UY-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter.
REFERENCE 10 (bases 1 to 4257) AUTHORS Cai,Y., Lechner,M.S., Nihalani,D., Prindle,M.J., Holzman,L.B. and Dressler,G.R.
TITLE Phosphorylation of Pax2 by the c-Jun N-terminal kinase and enhanced Pax2-dependent transcription activation JOURNAL J. Biol. Chem. 277 (2), 1217-1222 (2002) REFERENCE 11 (bases 1 to 4257) AUTHORS Becker,K., Beales,P.L., Calver,D.M., Matthijs,G. and Mohammed,S.N.
TITLE Okihiro syndrome and acro-renal-ocular syndrome: clinical overlap, expansion of the phenotype, and absence of PAX2 mutations in two new families JOURNAL J. Med. Genet. 39 (1), 68-71 (2002) REMARK GeneRIF: The absence of PAX2 mutations has been identified in two families with histories of clinical overlap of Okihiro and acro-renal-ocular syndromes.
REFERENCE 12 (bases 1 to 4257) AUTHORS Eccles,M.R., He,S., Legge,M., Kumar,R., Fox,J., Zhou,C., French,M.
and Tsai,R.W.
TITLE PAX genes in development and disease: the role of PAX2 in urogenital tract development JOURNAL Int. J. Dev. Biol. 46 (4), 535-544 (2002) REMARK Review article GeneRIF: PAX2 has a role in urogenital tract development and disease [review]
REFERENCE 13 (bases 1 to 4257) AUTHORS Chung,G.W., Edwards,A.O., Schimmenti,L.A., Manligas,G.S., Zhang,Y.H. and Ritter,R. III.
TITLE Renal-coloboma syndrome: report of a novel PAX2 gene mutation JOURNAL Am. J. Ophthalmol. 132 (6), 910-914 (2001) REMARK GeneRIF: The causal relationship between PAX2 gene mutations and renal-coloboma syndrome is further supported REFERENCE 14 (bases 1 to 4257) AUTHORS Nishimoto,K., Iijima,K., Shirakawa,T., Kitagawa,K., Satomura,K., Nakamura,H. and Yoshikawa,N.
TITLE PAX2 gene mutation in a family with isolated renal hypoplasia JOURNAL J. Am. Soc. Nephrol. 12 (8), 1769-1772 (2001) REFERENCE 15 (bases 1 to 4257) AUTHORS Ritz-Laser,B., Estreicher,A., Gauthier,B. and Philippe,J.
TITLE The paired homeodomain transcription factor Pax-2 is expressed in the endocrine pancreas and transactivates the glucagon gene promoter JOURNAL J. Biol. Chem. 275 (42), 32708-32715 (2000) REFERENCE 16 (bases 1 to 4257) AUTHORS Lechner,M.S., Levitan,I. and Dressler,G.R.
TITLE PTIP, a novel BRCT domain-containing protein interacts with Pax2 and is associated with active chromatin JOURNAL Nucleic Acids Res. 28 (14), 2741-2751 (2000) REFERENCE 17 (bases 1 to 4257) AUTHORS Tavassoli,K., Ruger,W. and Horst,J.
TITLE Alternative splicing in PAX2 generates a new reading frame and an extended conserved coding region at the carboxy terminus JOURNAL Hum. Genet. 101 (3), 371-375 (1997) REFERENCE 18 (bases 1 to 4257) AUTHORS Dahl,E., Koseki,H. and Balling,R.
TITLE Pax genes and organogenesis JOURNAL Bioessays 19 (9), 755-765 (1997) REIVIARK Review article REFERENCE 19 (bases 1 to 4257) AUTHORS Schimmenti,L.A., Cunliffe,H.E., McNoe,L.A., Ward,T.A., French,M.C., Shim,H.H., Zhang,Y.H., Proesmans,W., Leys,A., Byerly,K.A., Braddock,S.R., Masuno,M., Imaizumi,K., Devriendt,K. and Eccles,M.R.
TITLE Further delineation of renal-coloboma syndrome in patients with extreme variability of phenotype and identical PAX2 mutations JOURNAL Am. J. Hum. Genet. 60 (4), 869-878 (1997) REFERENCE 20 (bases 1 to 4257) AUTHORS Narahara,K., Baker,E., Ito,S., Yokoyama,Y., Yu,S., Hewitt,D., Sutherland,G.R., Eccles,M.R. and Richards,R.I.
TITLE Localisation of a 10q breakpoint within the PAX2 gene in a patient with a de novo t(10;13) translocation and optic nerve coloboma-renal disease JOURNAL J. Med. Genet. 34 (3), 213-216 (1997) REFERENCE 21 (bases 1 to 4257) AUTHORS Dehbi,M., Ghahremani,M., Lechner,M., Dressler,G. and Pelletier,J.
TITLE The paired-box transcription factor, PAX2, positively modulates expression of the Wilms' tumor suppressor gene (WT1) JOURNAL Oncogene 13 (3), 447-453 (1996) REFERENCE 22 (bases 1 to 4257) AUTHORS Sanyanusin,P., Norrish,J.H., Ward,T.A., Nebel,A., McNoe,L.A. and Eccles,M.R.
TITLE Genomic structure of the human PAX2 gene -- ----- ----- ---- -----JOURNAL Genomics 35 (1), 258-261 (1996) REFERENCE 23 (bases 1 to 4257) AUTHORS Sanyanusin,P., Schimrnenti,L.A., McNoe,L.A., Ward,T.A., Pierpont,M.E., Sullivan,M.J., Dobyns,W.B. and Eccles,M.R.
TITLE Mutation of the PAX2 gene in a family with optic nerve colobomas, renal anomalies and vesicoureteral reflux JOURNAL Nat. Genet. 9(4), 358-364 (1995) REFERENCE 24 (bases 1 to 4257) AUTHORS Ward,T.A., Nebel,A., Reeve,A.E. and Eccles,M.R.
TITLE Alternative messenger RNA forms and open reading frames within an additional conserved region of the human PAX-2 gene JOURNAL Cell Growth Differ. 5(9), 1015-1021 (1994) REFERENCE 25 (bases 1 to 4257) AUTHORS Noll,M.
TITLE Evolution and role of Pax genes JOURNAL Curr. Opin. Genet. Dev. 3 (4), 595-605 (1993) REMARK Review article REFERENCE 26 (bases 1 to 4257) AUTHORS Stapleton,P., Weith,A., Urbanek,P., Kozmik,Z. and Busslinger,M.
TITLE Chromosomal localization of seven PAX genes and cloning of a novel family member, PAX-9 JOURNAL Nat. Genet. 3 (4), 292-298 (1993) REFERENCE 27 (bases 1 to 4257) AUTHORS Pilz,A.J., Povey,S., Gruss,P. and Abbott,C.M.
TITLE Mapping of the human homologs of the murine paired-box-containing genes JOURNAL Mamm. Genome 4(2), 78-82 (1993) REFERENCE 28 (bases.1 to 4257) AUTHORS Eccles,M.R., Wallis,L.J., Fidler,A.E., Spurr,N.K., Goodfellow,P.J.
and Reeve,A.E.
TITLE Expression of the PAX2 gene in human fetal kidney and Wilms' tumor JOURNAL Cell Growth Differ. 3 (5), 279-289 (1992) COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff.
The reference sequence was derived from U45255.1 and BM671839.1.
On Sep 22, 2003 this sequence version replaced gi:4557828.
Summary: PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT 1.
Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.
Transcript Variant: This variant (e) encodes the longest isoform (e).
COMPLETENESS: complete on the 3' end.
FEATUR.ES Location/Qualifiers source 1..4257 /organism="Homo sapiens"
/mol type="mRNA"
/dbxref--"taxon:9606"
/chromosome=" 10"
/map=" 10q24"
gene 1..4257 /gene="PAX2"
/dbxref="GeneID: 5 076"
/db_xref--"HGNC:8616"
/db_xref="M1M:167409"
CDS 687..1982 /gene="PAX2"
/note="PAX2 gene is a member of the paired-box containing genes which encode transcription factors involved in embryonic and fetal development; the gene product is nuclear protein which binds DNA
isoform e is encoded by transcript variant e; paired box homeotic gene 2;
go_component: nucleus [goid 0005634] [evidence IEA];
go_function: ATP binding [goid 0005524] [evidence IEA];
go_function: DNA binding [goid 0003677] [evidence TEA];
go_fitnction: DNA binding [goid 0003677] [evidence TAS]
[pmid 9106533];
go_function: nucleoside diphosphate kinase activity [goid 0004550] [evidence IEA];
go_process: development [goid 0007275] [evidence IEA];
go_process: transcription [goid 0006350] [evidence lEA];
go_process: CTP biosynthesis [goid 0006241] [evidence IEA];
go_process: GTP biosynthesis [goid 0006183] [evidence IEA]; , go_process: UTP biosynthesis [goid 0006228] [evidence IEA];
go_process: axonogenesis [goid 00074091 [evidence TAS]
[pmid 9106533];
go_process: cell differentiation [goid 0030154] [evidence IEA];
go_process: visual perception [goid 0007601] [evidence TAS] [pmid 9106533];
go_process: regulation of transcription, DNA-dependent [goid 0006355] [evidence I]EA];
go_process: transcription from RNA polymerase II promoter [goid 0006366] [evidence TAS] [pmid 8760285]"
/codon_start=l /product="paired box protein 2 isoform e"
/protein id="NP_003981.2"
/db_xref--" GI:34878703"
/dbxref--"GeneID:5076"
/db_xref--"HGNC:8616"
/db xref--"MIM:167409"
/translation="MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDV VRQRIVELAH
QGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKV VDKIAEYK
RQNPTMFAWEIRDRLLAEGICDNDTVPS VSSINRIIRTKVQQPFHPTPDGAGTGVTA
PGHTNPSTASPPVS SASNDPVGSYSINGILGIPRSNGEKRKRDEVEVYTDPAHIRGG
GGLHLV WTLRDV SEGS VPNGDS QS GVD SLRKHLRADTFTQQQLEALDRVFERPSY
PD VFQASEHIKSEQGNEYSLPALTPGLDEVKS SLSASTNPELGSNV S GTQTYPV VTG
RDMASTTLPGYPPHVPPTGQGSYPTS TLAGMVPGSEFS GNPYSHPQYTAYNEAWRF
SNPALLMPPPGPPLPLLPLPMTATSYRGDHIKLQADSFGLHIVPV"
STS 1907..2113 /gene="PAX2"
/standard_name="RH80285"
/db_xre f--"Uni S T S: 8 8 43 7"
STS 3105..3257 /gene="PAX2"
/standard_name="D 10S2478"
/db_xref-'-"UniSTS :74159"
polyA signal 4211..4216 /gene="PAX2"
polyA_signal 4215..4220 /gene="PAX2"
polyA_signal 4222..4227 /gene="PAX2"
polyA site 4240 /gene="PAX2"
ORIGIN
1 aggctccagt ctccggccga gtcttctcgc agccgcaacc cacctggggc cagcccagag 61 ctgccagcgc cgctcggctc cctccctccc tcccggccct tcggccgcgg cggcgtgcgc 121 ctgccttttc cgggggcggg ggcctggccc gcgcgctccc ctcccgcagg cgccacctcg 181 gacatccccg ggattgctac ttctctgcca acttcgccaa ctcgccagca cttggagagg 241 cccggctccc ctcccggcgc cctctgaccg cccccgcccc gcgcgctctc cgaccaccgc 301 ctctcggatg accaggttcc aggggagctg agcgagtcgc ctcccccgcc cagcttcagc 361 cctggctgca gctgcagcgc gagccatgcg cccccagtgc accccggccc ggcccaccgc 421 cccggggcca ttctgctgac cgcccagccc cgagccccga cagtggcaag ttgcggctac 481 tgcagttgca agctccggcc aacccggagg agccccagcg gggagcgcag tgttgcgccc 541 cccgcccccg cgcgccccgc agcagccggg cgttcactca tcctccctcc cccaccgtcc 601 ctcccttttc tcctcaagtc ctgaagttga gtttgagagg cgacacggcg gcggcggccg 661 cgctgctccc gctcctctgc ctccccatgg atatgcactg caaagcagac cccttctccg 721 cgatgcaccc agggcacggg ggtgtgaacc agctcggggg ggtgtttgtg aacggccggc 781 ccctacccga cgtggtgagg cagcgcatcg tggagctggc ccaccagggt gtgcggccct 841 gtgacatctc ccggcagctg cgggtcagcc acggctgtgt cagcaaaatc ctgggcaggt 901 actacgagac cggcagcatc aagccgggtg tgatcggtgg ctccaagccc aaagtggcga 961 cgcccaaagt ggtggacaag attgctgaat acaaacgaca gaacccgact atgttcgcct 1021 gggagattcg agaccggctc ctggccgagg gcatctgtga caatgacaca gtgcccagcg 1081 tctcttccat caacagaatc atccggacca aagttcagca gcctttccac ccaacgccgg 1141 atggggctgg gacaggagtg accgcccctg gccacaccat tgttcccagc acggcctccc 1201 ctcctgtttc cagcgcctcc aatgacccag tgggatccta ctccatcaat gggatcctgg 1261 ggattcctcg ctccaatggt gagaagagga aacgtgatga agttgaggta tacactgatc 1321 ctgcccacat tagaggaggt ggaggtttgc atctggtctg gactttaaga gatgtgtctg 1381 agggctcagt ccccaatgga gattcccaga gtggtgtgga cagtttgcgg aagcacttgc 1441 gagctgacac cttcacccag cagcagctgg aagctttgga tcgggtcttt gagcgtcctt 1501 cctaccctga cgtcttccag gcatcagagc acatcaaatc agaacagggg aacgagtact 1561 ccctcccagc cctgacccct gggcttgatg aagtcaagtc gagtctatct gcatccacca 1621 accctgagct gggcagcaac gtgtcaggca cacagacata cccagttgtg actggtcgtg 1681 acatggcgag caccactctg cctggttacc cccctcacgt gccccccact ggccagggaa 1741 gctaccccac ctccaccctg gcaggaatgg tgcctgggag cgagttctcc ggcaacccgt 1801 acagccaccc ccagtacacg gcctacaacg aggcttggag attcagcaac cccgccttac 1861 taatgccgcc ccccggtccg cccctgccgc tgctgccgct gcctatgacc gccactagtt 1921 accgcgggga ccacatcaag cttcaggccg acagcttcgg cctccacatc gtccccgtct 1981 gaccccaccc cggagggagg gaggaccgac gcgacgcgatgcctcccggc caccgcccca 2041 gcctcacccc atcccacgac ccccgcaacc cttcacatca cccccctcga aggtcggaca 2101 ggacgggtgg agccgtgggc gggaccctca ggcccgggcc cgccgccccc agccccgcct 2161 gccgcccctc cccgcctgcc tggactgcgc ggcgccgtga gggggattcg gcccagctcg 2221 tcccggcctc caccaagcca gccccgaagc ccgccagcca ccctgccgga ctcgggcgcg 2281 acctgctggc gcgcgccgga tgtttctgtg acacacaatc agcgcggacc gcagcgcggc 2341 ccagccccgg gcacccgcct cggacgctcg ggcgccagga ggcttcgctg gaggggctgg 2401 gccaaggaga ttaagaagaa aacgactttc tgcaggagga agagcccgct gccgaatccc 2461 tgggaaaaat tcttttcccc cagtgccagc cggactgccc tcgccttccg ggtgtgccct 2521 gtcccagaag atggaatggg ggtgtggggg tccggctcta ggaacgggct ttgggggcgt 2581 caggtctttc caaggttggg acccaaggat cggggggccc agcagcccgc accgatcgag 2641 ccggactctc ggctcttcac tgctcctcct ggcctgccta gttccccagg gcccggcacc 2701 tcctgctgcg agacccggct ctcagccctg ccttgcccct acctcagcgt ctcttccacc 2761 tgctggcctc ccagtttccc ctcctgccag tccttcgcct gtcccttgac gccctgcatc 2821 ctcctccctg actcgcagcc ccatcggacg ctctcccggg accgccgcag gaccagtttc 2881 catagactgc ggactggggt cttcctccag cagttacttg atgccccctc ccccgacaca 2941 gactctcaat ctgccggtgg taagaaccgg ttctgagctg gcgtctgagc tgctgcgggg 3001 tggaagtggg gggctgccca ctccactcct cccatcccct cccagcctcc tcctccggca 3061 ggaactgaac agaaccacaa aaagtctaca tttatttaat atgatggtct ttgcaaaaag 3121 gaacaaaaca acacaaaagc ccaccaggct gctgctttgt ggaaagacgg tgtgtgtcgt 3181 gtgaaggcga aacccggtgt acataacccc tccccctccg ccccgccccg cccggccccg 3241 tagagtccct gtcgcccgcc ggccctgcct gtagatacgc cccgctgtct gtgctgtgag 3301 agtcgccgct cgctgggggg gaaggggggg acacagctac acgcccatta aagcacagca 3361 cgtcctgggg gaggggggca ttttttatgt tacaaaaaaa aattacgaaa gaaaagaaat 3421 ctctatgcaa aatgacgaac atggtcctgt ggactcctct ggcctgtttt gttggctctt 3481 tctctgtaat tccgtgtttt cgctttttcc tccctgcccc tctctccctc tgcccctctc 3541 tcctctccgc ttctctcccc ctctgtctct gtctctctcc gtctctgtcg ctcttgtctg 3601 tctgtctctg ctctttcctc ggcctctctc cccagacctg gcccggccgc cctgtctccg 3661 caggctagat ccgaggtggc agctccagcc cccgggctcg ccccctcgcg ggcgtgcccc 3721 gcgcgccccg ggcggccgaa ggccgggccg ccccgtcccg ccccgtagtt gctctttcgg 3781 tagtggcgat gcgccctgca tgtctcctca cccgtggatc gtgacgactc gaaataacag 3841 aaacaaagtc aataaagtga aaataaataa aaatccttga acaaatccga aaaggcttgg 3901 agtcctcgcc cagatctctc tcccctgcga gcccttttta tttgagaagg aaaaagagaa 3961 aagagaatcg tttaagggaa cccggcgccc agccaggctc cagtggcccg aacggggcgg 4021 cgagggcggc gagggcgccg aggtccggcc catcccagtc ctgtggggct ggccgggcag 4081 agaccccgga cccaggccca ggcctaacct gctaaatgtc cccggacggt tctggtctcc 4141 tcggccactt tcagtgcgtc ggttcgtttt gattcttttt cttttgtgca cataagaaat 4201 aaataataat aataaataaa gaataaaatt ttgtatgtca aaaaaaaaaa aaaaaaa cn ~ cn U
M
U
U U
U
U
C~7 U
u u tn cn U
U
E-H
M
~ M C~7 U
y U U
U
U ~
[.~ u QD U
M p U C7 d v v ~2 Q
O M M M M
Q,=
M N ~ t O Q' o~o ~D Z
rA Q Q Q Q
N ~ a a a ~a ~
M M M N
~
~D Z ~D Z
0~ w u W
rA
F-Q U
~ U U H U
Cd ~ E-Ui U U
H U
H U F~-+ C7 = ~ H CU7 U C~7 ~
~
r4 cn Z M F~-+ U U
Q
a ~ U U H
p' U L~7 H U
~ a Q q Q
~
Throughout this application, various publications are referenced. The disclosures of these publications in their entireties are hereby incorporated by reference into this application in order to more fully describe the state of the art to which this invention pertains.
References 1. Jemal, A.; Tiwari, R. C.; Murray, T.; Ghafoor, A.; Samuels, A.; Ward, E.;
Feuer, E.
J.; Thun, M. J., Cancer statistics, 2004. CA Cancer J Clin 2004, 54, (1), 8-29.
2. Prasad, M. A.; Trybus, T. M.; Wojno, K. J.; Macoska, J. A., Homozygous and frequent deletion of proximal 8p sequences in human prostate cancers:
identification of a potential tumor suppressor gene site. Genes Chromosomes Cancer 1998, 23, (3), 255-62.
3. McNeel, D. G.; Malkovsky, M., Immune-based therapies for prostate cancer.
Immunology Letters 2005, 96, (1), 3.
4. Tien, A. H.; Xu, L.; Helgason, C. D., Altered Ixnxnunity. Accompanies Disease Progression in a Mouse Model of Prostate Dysplasia. Cancer Res 2005, 65, (7), 2947-2955.
5. Banchereau, J.; Palucka, A. K.; Dhodapkar, M.; Burkeholder, S.; Taquet, N.;
Rolland, A.; Taquet, S.; Coquery, S.; Wittkowski, K. M.; Bhardwaj, N.;
Pineiro, L.;
Steinman, R.; Fay, J., Immune and Clinical Responses in Patients with Metastatic Melanoma to CD34+ Progenitor-derived Dendritic Cell Vaccine. Cancer Res, 2001, 61, (17), 6451-6458.
6. Fong, L.; Brockstedt, D.; Benike, C.; Breen, J. K.; Strang, G.; Ruegg, C.
L.;
Engleman, E. G., Dendritic Cell-Based Xenoantigen Vaccination for Prostate Cancer Irrununotherapy. Jlmrnuraol 2001, 167, (12), 7150-7156.
7. Linzmeier, R.; Ho, C. H.; Hoang, B. V.; Ganz, T., A 450-kb contig of defensin genes on human chromosome 8p23. Gene 1999, 233, (1-2), 205-11.
8. Yang, D.; Biragyn, A.; Hoover, D. M.; Lubkowski, J.; Oppenheim, J. J., Multiple Roles of Antimicrobial Defensins, Cathelicidins, and Eosinophil-Derived Neurotoxin in Host Defense. Annual Review ofImmunology 2004, 22, (1), 181-215.
9. Donald, C. D.; Sun, C. Q.; Lim, S. D.; Macoska, J.; Cohen, C.; Amin, M. B.;
Young, A. N.; Ganz, T. A.; Marshall, F. F.; Petros, J. A., Cancer-specific loss of beta-defensin 1 in renal and prostatic carcinomas. Lab Invest 2003, 83, (4), 501-5.
Young, A. N.; Ganz, T. A.; Marshall, F. F.; Petros, J. A., Cancer-specific loss of beta-defensin 1 in renal and prostatic carcinomas. Lab Invest 2003, 83, (4), 501-5.
10. Ganz, T., Defensins: antimicrobial peptides of vertebrates. C R Biol 2004, 327, (6), 539-49.
-1."_ Mazzucchelli, R.; Barbisan, F.; Tarquini, L. M.; Galosi, A. B.;
Stramazzotti, D., Molecular mechanisms in prostate cancer. A review. Anal Quant Cytol Histol 2004, 26, (3), 127-33.
12. Ganz, T., Defensins and host defense. Science 1999, 286, (5439), 420-1.
13. Ganz, T., Inimunology. Versatile defensins. Science 2002, 298, (5595), 977-9.
14. Braida, L.; Boniotto, M.; Pontillo, A.; Tovo, P. A.; Amoroso, A.;
Crovella, S., A
single-nucleotide polymorphism in the human beta-defensin 1 gene is associated with HIV-1 infection in Italian children. Aids 2004, 18, (11), 1598-600.
15. Gropp, R.; Frye, M.; Wagner, T. 0.; Bargon, J., Epithelial defensins impair adenoviral infection: implication for adenovirus-mediated gene therapy. Hum Gene Ther 1999, 10, (6), 957-64.
16. Catalano, M. G.; Pfeffer, U.; Raineri, M.; Ferro, P.; Curto, A.; Capuzzi, P.; Como, F.; Berta, L.; Fortunati, N., Altered expression of androgen-receptor isoforms in human colon-cancer tissues. Int J Cancer 2000, 86, (3), 325-30.
17. Takeuchi, S.; lida, M.; Kobayashi, S.; Jin, K.; Matsuda, T.; Kojima, H., Differential effects of phthalate esters on transcriptional activities via human estrogen receptors alpha and beta, and androgen receptor. Toxicology 2005, 210, (2-3), 223-33.
18. Zucht, H. D.; Grabowsky, J.; Schrader, M.; Liepke, C.; Jurgens, M.; Schulz-Knappe, P.; Forssmann, W. G., Human beta-defensin-1: A urinary peptide present in variant molecular forms and its putative functional implication. Eur JMed Res 1998, 3, (7), 315-23.
19. Nishimura, M.; Abiko, Y.; Kurashige, Y.; Takeshima, M.; Yamazaki, M.;
Kusano, K.; Saitoh, M.; Nakashima, K.; Inoue, T.; Kaku, T., Effect of defensin peptides on eukaryotic cells: primary epithelial cells, fibroblasts and squamous cell carcinoma cell lines.
Journal ofDermatological Science 2004, 36, (2), 87.
20. Fromont, G.; Joulin, V.; Chantrel-Groussard, K.; Vallancien, G.;
Guillonneau, B.;
Validire, P.; Latil, A.; Cussenot, 0., Allelic losses in localized prostate cancer: association with prognostic factors. J Urol 2003, 170, (4 Pt 1), 1394-7.
21. Wang, Z.; Lai, F. M., [Analysis of loss of heterozygosity on chromosome 8 in human prostate carcinoma and high grade prostatic intraepithelial neoplasia].
Zhonghua Nan KeXue 2004, 10, (1), 26-8, 31.
22. Hugel, A.; Wernert, N., Loss of heterozygosity (LOH), malignancy grade and clonality in microdissected prostate cancer. Br J Cancer 1999, 79, (3-4), 551-7.
23: Bockmuhl, U.; Ishwad, C. S.; Ferrell, R. E.; Gollin, S. M., Association of 8p23 deletions with poor survival in head and neck cancer. Otolaryngol Head Neck Surg 2001, 124, (4), 451-5.
24. Macoska, J. A.; Paris, P.; Collins, C.; Andaya, A.; Beheshti, B.; Chaib, H.; Kant, R.;
Begley, L.; MacDonald, J. W.; Squire, J. A., Evolution of 8p loss in transformed human prostate epithelial cells. Cancer Genet Cytogenet 2004, 154, (1), 36-43.
25. Chaib, H.; MacDonald, J. W.; Vessella, R. L.; Washburn, J. G.; Quinn, J.
E.;
Odman, A.; Rubin, M. A.; Macoska, J. A., Haploinsufficiency and reduced expression of genes localized to the 8p chromosomal region in human prostate tumors. Genes Claromosomes Cancer 2003, 37, (3), 306-13.
26. Teixeira, M. R.; Ribeiro, F. R.; Eknaes, M.; Waehre, H.; Stenwig, A. E.;
Giercksky, K. E.; Heim, S.; Lothe, R. A., Genomic analysis of prostate carcinoma specimens obtained via ultrasound-guided needle biopsy may be of use in preoperative decision-making. Cancer 2004, 101, (8), 1786-93.
27. Vecchione, A.; Ishii, H.; Baldassarre, G.; Bassi, P.; Trapasso, F.; Alder, H.; Pagano, F.; Gomella, L. G.; Croce, C. M.; Baffa, R., FEZ1/LZTS1 is down-regulated in high-grade bladder cancer, and its restoration suppresses tumorigenicity in transitional cell carcinoma cells. Am JPathol 2002, 160, (4), 1345-52.
28. Valore, E. V.; Park, C. H.; Quayle, A. J.; Wiles, K. R.; McCray, P. B., Jr.; Ganz, T., Human beta-defensin-1: an antimicrobial peptide of urogenital tissues. J Clin Invest 1998, 101, (8), 1633-42.
29. Gunther, M.; Wagner, E.; Ogris, M., Specific targets in tumor tissue for the delivery of therapeutic genes. Curr Med Chem Anti-Canc Agents 2005, 5, (2), 157-71.
30. Dressler, G. R., Pax-2, kidney development, and oncogenesis. Med Pediatr Oncol 1996, 27, (5), 440-4.
31. Eccles, M. R.; He, S.; Legge, M.; Kumar, R.; Fox, J.; Zhou, C.; French, M.; Tsai, R.
W., PAX genes in development and disease: the role of PAX2 in urogenital tract development. Int JDev Biol 2002, 46, (4), 535-44.
32. Dressler, G. R.; Woolf, A. S., Pax2 in development and renal disease. Int JDev Biol 1999, 43, (5), 463-8.
33. Khoubehi, B.; Kessling, A. M.; Adshead, J. M.; Smith, G. L.; Smith, R. D.;
Ogden, C. W., Expression of the developmental and oncogenic PAX2 gene in human prostate cancer. J Urol 2001, 165, (6 Pt 1), 2115-20.
34. Havik, B.; Ragnhildstveit, E.; Lorens, J. B.; Saelemyr, K.; Fauske, 0.;
Knudsen, L.
K.; Fjose, A., A novel paired domain DNA recognition motif can mediate Pax2 repression of gene transcription. Biochem Bioplays Res Commun 1999, 266, (2), 532-41.
35. Discenza, M. T.; He, S.; Lee, T. H.; Chu, L. L.; Bolon, B.; Goodyer, P.;
Eccles, M.;
Pelletier, J., WT1 is a modifier of the Pax2 mutant phenotype: cooperation and interaction between WTl and Pax2. Oncogene 2003, 22, (50), 8145-55.
36. McConnell, M. J.; Cunliffe, H. E.; Chua, L. J.; Ward, T. A.; Eccles, M.
R., Differential regulation of the human Wilms tumour suppressor gene (WT1) promoter by two isoforms of PAX2. Oncogene 1997, 14, (22), 2689-700.
37. Yuan, S. S.; Yeh, Y. T.; Lee, E. Y., Pax-2 interacts with RB and reverses its repression on the promoter of Rig-1, a Robo member. Bioclaem Biophys Res Commun 2002, 296, (4), 1019-25.
38. Stuart, E. T.; Haffner, R.; Oren, M.; Gruss, P., Loss of p53 function tlirough PAX-mediated transcriptional repression. Embo .I1995, 14, (22), 5638-45.
39. Michalak, E.; Villunger, A.; Erlacher, M.; Strasser, A., Death squads enlisted by the tumour suppressor p53. Biochem Biophys Res Commun 2005, 331, (3), 786-98.
40. Tokino, T.; Nakamura, Y., The role of p53-target genes in human cancer.
Crit Rev Oncol Hematol 2000, 33, (1), 1-6.
41. Muratovska, A.; Zhou, C.; He, S.; Goodyer, P.; Eccles, M. R., Paired-Box genes are frequently expressed in cancer and often required for cancer cell survival.
Oncogene 2003, 22, (39), 7989-97.
42. Tagge, E. P.; Hanson, P.; Re, G. G.; Othersen, H. B., Jr.; Sxnith, C. D.;
Garvin, A. J., Paired box gene expression in Wilms' tumor. JPediatn Surg 1994, 29, (2), 134-41.
43. Murer, L.; Caridi, G.; Della Vella, M.; Montini, G.; Carasi, C.; Ghiggeri, G.;
Zacchello, G., Expression of nuclear transcription factor PAX2 in renal biopsies of juvenile nephronophthisis. Nephron 2002, 91, (4), 588-93.
44. Eccles, M. R.; Wallis, L. J.; Fidler, A. E.; Spurr, N. K.; Goodfellow, P.
J.; Reeve, A.
E., Expression of the PAX2 gene in human fetal kidney and Wihns' tumor. Cell Growth Differ 1992, 3, (5), 279-89.
45. Ogata, T.; Muroya, K.; Sasagawa, I.; Kosho, T.; Wakui, K.; Sakazume, S.;
Ito, K.;
Matsuo, N.; Ohashi, H.; Nagai, T., Genetic evidence for a novel gene(s) involved in urogenital development on 10q26. Kidneylnt 2000, 58, (6), 2281-90.
4b. Ostrom, L.; Tang, M. J.; Grass, P.; Dressler, G. R., Reduced Pax2 gene dosage increases apoptosis and slows the progression of renal cystic disease. Dev Biol 2000, 219, (2), 250-8.
47. Mazal, P. R.; Stichenwirth, M.; Koller, A.; Blach, S.; Haitel, A.; Susani, M., Expression of aquaporins and PAX-2 compared to CD 10 and cytokeratin 7 in renal neoplasms: a tissue microarray study. Mod Pathol 2005, 18, (4), 535-40.
48. Buttiglieri, S.; Deregibus, M. C.; Bravo, S.; Cassoni, P.; Chiarle, R.;
Bussolati, B.;
Camussi, G., Role of Pax2 in apoptosis resistance and proinvasive phenotype of Kaposi's sarcoma cells. JBiol Chem 2004, 279, (6), 4136-43.
49. Gnarra, J. R.; Dressler, G. R., Expression of Pax-2 in human renal cell carcinoma and growth inhibition by antisense oligonucleotides. Cancer Res 1995, 55, (18), 4092-8.
50. Strasser, A., The role of BH3-only proteins in the immune system. Nat RevImmunol 2005, 5, (3), 189-200.
51. Lin, S.; Ying, S. Y., Differentially expressed genes in activin-induced apoptotic LNCaP cells. Bioclaem Biophys Res Comnaun 1999, 257, (1), 187-92.
52. Perfettini, J. L.; Kroemer, R. T.; Kroemer, G., Fatal liaisons of p53 with Bax and Bak. Nat Cell Biol 2004, 6, (5), 386-8.
53. Coultas, L.; Strasser, A., The role of the Bcl-2 protein family in cancer.
Semin Cancer Biol 2003, 13, (2), 115-23.
54. Margue, C. M.; Bernasconi, M.; Barr, F. G.; Schafer, B. W., Transcriptional modulation of the anti-apoptotic protein BCL-XL by the paired box transcription factors PAX3 and PAX3/FKHR. Oncogene 2000,19, (25), 2921-9.
55. Nakamura, Y., Isolation of p53-target genes and their functional analysis.
Cancer Sci 2004, 95, (1), 7-11.
56. Perfettini, J. L.; Roumier, T.; Kroemer, G., Mitochondrial fusion and fission in the control of apoptosis. Trends Cell Biol 2005, 15, (4), 179-83.
57. Orlando, V. Mapping chromosomal proteins in vivo by fonnaldehyde-crosslinked-chromatin immunoprecipitation. Trends Biochem Sci, 25: 99-104., 2000.
58. Boyd, K. E. and Farnham, P. J. Coexamination of site-specific transcription factor binding and promoter activity in living cells. Mol Cell Biol, 19: 8393-8399., 1999.
59. Wells, J. and Farnham, P. J. Characterizing transcription factor binding sites using formaldehyde crosslinking and immunoprecipitation. Methods, 26: 48-56., 2002.
60. Sikorski, R. S. and Hieter, P. A system of shuttle vectors and yeast host strains designed for efficient manipulation of DNA in Saccharomyces cerevisiae.
Genetics, 122:
19-27., 1989.
61. Nigro, J. M., Sikorski, R., Reed, S. I., and Vogelstein, B. Human p53 and CDC2Hs genes combine to inhibit the proliferation of Saccharomyces cerevisiae. Mol Cell Biol, 12:
1357-1365., 1992.
62. Wilson, T. E., Fahrner, T. J., Johnston, M., and Milbrandt, J.
Identification of the DNA binding site for NGFI-B by genetic selection in yeast. Science, 252: 1296-13 00., 1991.
63. Liu, J., Wilson, T. E., Milbrandt, J., and Johnsen, M. Identifying DNA-binding sites and analyzing DNA-binding domains using a yeast selection system. METHODS: A
companion to Methods in Enzymology, 5: 125-137, 1993.
64. Jackers, P., Szalai, G., and Watson, D. K. Ets-dependent regulation of target gene expression during megakaryopoiesis. in preparation, 2003.
It will be apparent to those skilled in the art that various modifications and variations can be made in the present invention without departing from the scope or spirit of the invention. Other embodiments of the invention will be apparent to those skilled in the art from consideration of the specification and practice of the invention disclosed herein. It is intended that the specification and examples be considered as exemplary only, with a true scope and spirit of the invention being indicated by the following claims.
-1."_ Mazzucchelli, R.; Barbisan, F.; Tarquini, L. M.; Galosi, A. B.;
Stramazzotti, D., Molecular mechanisms in prostate cancer. A review. Anal Quant Cytol Histol 2004, 26, (3), 127-33.
12. Ganz, T., Defensins and host defense. Science 1999, 286, (5439), 420-1.
13. Ganz, T., Inimunology. Versatile defensins. Science 2002, 298, (5595), 977-9.
14. Braida, L.; Boniotto, M.; Pontillo, A.; Tovo, P. A.; Amoroso, A.;
Crovella, S., A
single-nucleotide polymorphism in the human beta-defensin 1 gene is associated with HIV-1 infection in Italian children. Aids 2004, 18, (11), 1598-600.
15. Gropp, R.; Frye, M.; Wagner, T. 0.; Bargon, J., Epithelial defensins impair adenoviral infection: implication for adenovirus-mediated gene therapy. Hum Gene Ther 1999, 10, (6), 957-64.
16. Catalano, M. G.; Pfeffer, U.; Raineri, M.; Ferro, P.; Curto, A.; Capuzzi, P.; Como, F.; Berta, L.; Fortunati, N., Altered expression of androgen-receptor isoforms in human colon-cancer tissues. Int J Cancer 2000, 86, (3), 325-30.
17. Takeuchi, S.; lida, M.; Kobayashi, S.; Jin, K.; Matsuda, T.; Kojima, H., Differential effects of phthalate esters on transcriptional activities via human estrogen receptors alpha and beta, and androgen receptor. Toxicology 2005, 210, (2-3), 223-33.
18. Zucht, H. D.; Grabowsky, J.; Schrader, M.; Liepke, C.; Jurgens, M.; Schulz-Knappe, P.; Forssmann, W. G., Human beta-defensin-1: A urinary peptide present in variant molecular forms and its putative functional implication. Eur JMed Res 1998, 3, (7), 315-23.
19. Nishimura, M.; Abiko, Y.; Kurashige, Y.; Takeshima, M.; Yamazaki, M.;
Kusano, K.; Saitoh, M.; Nakashima, K.; Inoue, T.; Kaku, T., Effect of defensin peptides on eukaryotic cells: primary epithelial cells, fibroblasts and squamous cell carcinoma cell lines.
Journal ofDermatological Science 2004, 36, (2), 87.
20. Fromont, G.; Joulin, V.; Chantrel-Groussard, K.; Vallancien, G.;
Guillonneau, B.;
Validire, P.; Latil, A.; Cussenot, 0., Allelic losses in localized prostate cancer: association with prognostic factors. J Urol 2003, 170, (4 Pt 1), 1394-7.
21. Wang, Z.; Lai, F. M., [Analysis of loss of heterozygosity on chromosome 8 in human prostate carcinoma and high grade prostatic intraepithelial neoplasia].
Zhonghua Nan KeXue 2004, 10, (1), 26-8, 31.
22. Hugel, A.; Wernert, N., Loss of heterozygosity (LOH), malignancy grade and clonality in microdissected prostate cancer. Br J Cancer 1999, 79, (3-4), 551-7.
23: Bockmuhl, U.; Ishwad, C. S.; Ferrell, R. E.; Gollin, S. M., Association of 8p23 deletions with poor survival in head and neck cancer. Otolaryngol Head Neck Surg 2001, 124, (4), 451-5.
24. Macoska, J. A.; Paris, P.; Collins, C.; Andaya, A.; Beheshti, B.; Chaib, H.; Kant, R.;
Begley, L.; MacDonald, J. W.; Squire, J. A., Evolution of 8p loss in transformed human prostate epithelial cells. Cancer Genet Cytogenet 2004, 154, (1), 36-43.
25. Chaib, H.; MacDonald, J. W.; Vessella, R. L.; Washburn, J. G.; Quinn, J.
E.;
Odman, A.; Rubin, M. A.; Macoska, J. A., Haploinsufficiency and reduced expression of genes localized to the 8p chromosomal region in human prostate tumors. Genes Claromosomes Cancer 2003, 37, (3), 306-13.
26. Teixeira, M. R.; Ribeiro, F. R.; Eknaes, M.; Waehre, H.; Stenwig, A. E.;
Giercksky, K. E.; Heim, S.; Lothe, R. A., Genomic analysis of prostate carcinoma specimens obtained via ultrasound-guided needle biopsy may be of use in preoperative decision-making. Cancer 2004, 101, (8), 1786-93.
27. Vecchione, A.; Ishii, H.; Baldassarre, G.; Bassi, P.; Trapasso, F.; Alder, H.; Pagano, F.; Gomella, L. G.; Croce, C. M.; Baffa, R., FEZ1/LZTS1 is down-regulated in high-grade bladder cancer, and its restoration suppresses tumorigenicity in transitional cell carcinoma cells. Am JPathol 2002, 160, (4), 1345-52.
28. Valore, E. V.; Park, C. H.; Quayle, A. J.; Wiles, K. R.; McCray, P. B., Jr.; Ganz, T., Human beta-defensin-1: an antimicrobial peptide of urogenital tissues. J Clin Invest 1998, 101, (8), 1633-42.
29. Gunther, M.; Wagner, E.; Ogris, M., Specific targets in tumor tissue for the delivery of therapeutic genes. Curr Med Chem Anti-Canc Agents 2005, 5, (2), 157-71.
30. Dressler, G. R., Pax-2, kidney development, and oncogenesis. Med Pediatr Oncol 1996, 27, (5), 440-4.
31. Eccles, M. R.; He, S.; Legge, M.; Kumar, R.; Fox, J.; Zhou, C.; French, M.; Tsai, R.
W., PAX genes in development and disease: the role of PAX2 in urogenital tract development. Int JDev Biol 2002, 46, (4), 535-44.
32. Dressler, G. R.; Woolf, A. S., Pax2 in development and renal disease. Int JDev Biol 1999, 43, (5), 463-8.
33. Khoubehi, B.; Kessling, A. M.; Adshead, J. M.; Smith, G. L.; Smith, R. D.;
Ogden, C. W., Expression of the developmental and oncogenic PAX2 gene in human prostate cancer. J Urol 2001, 165, (6 Pt 1), 2115-20.
34. Havik, B.; Ragnhildstveit, E.; Lorens, J. B.; Saelemyr, K.; Fauske, 0.;
Knudsen, L.
K.; Fjose, A., A novel paired domain DNA recognition motif can mediate Pax2 repression of gene transcription. Biochem Bioplays Res Commun 1999, 266, (2), 532-41.
35. Discenza, M. T.; He, S.; Lee, T. H.; Chu, L. L.; Bolon, B.; Goodyer, P.;
Eccles, M.;
Pelletier, J., WT1 is a modifier of the Pax2 mutant phenotype: cooperation and interaction between WTl and Pax2. Oncogene 2003, 22, (50), 8145-55.
36. McConnell, M. J.; Cunliffe, H. E.; Chua, L. J.; Ward, T. A.; Eccles, M.
R., Differential regulation of the human Wilms tumour suppressor gene (WT1) promoter by two isoforms of PAX2. Oncogene 1997, 14, (22), 2689-700.
37. Yuan, S. S.; Yeh, Y. T.; Lee, E. Y., Pax-2 interacts with RB and reverses its repression on the promoter of Rig-1, a Robo member. Bioclaem Biophys Res Commun 2002, 296, (4), 1019-25.
38. Stuart, E. T.; Haffner, R.; Oren, M.; Gruss, P., Loss of p53 function tlirough PAX-mediated transcriptional repression. Embo .I1995, 14, (22), 5638-45.
39. Michalak, E.; Villunger, A.; Erlacher, M.; Strasser, A., Death squads enlisted by the tumour suppressor p53. Biochem Biophys Res Commun 2005, 331, (3), 786-98.
40. Tokino, T.; Nakamura, Y., The role of p53-target genes in human cancer.
Crit Rev Oncol Hematol 2000, 33, (1), 1-6.
41. Muratovska, A.; Zhou, C.; He, S.; Goodyer, P.; Eccles, M. R., Paired-Box genes are frequently expressed in cancer and often required for cancer cell survival.
Oncogene 2003, 22, (39), 7989-97.
42. Tagge, E. P.; Hanson, P.; Re, G. G.; Othersen, H. B., Jr.; Sxnith, C. D.;
Garvin, A. J., Paired box gene expression in Wilms' tumor. JPediatn Surg 1994, 29, (2), 134-41.
43. Murer, L.; Caridi, G.; Della Vella, M.; Montini, G.; Carasi, C.; Ghiggeri, G.;
Zacchello, G., Expression of nuclear transcription factor PAX2 in renal biopsies of juvenile nephronophthisis. Nephron 2002, 91, (4), 588-93.
44. Eccles, M. R.; Wallis, L. J.; Fidler, A. E.; Spurr, N. K.; Goodfellow, P.
J.; Reeve, A.
E., Expression of the PAX2 gene in human fetal kidney and Wihns' tumor. Cell Growth Differ 1992, 3, (5), 279-89.
45. Ogata, T.; Muroya, K.; Sasagawa, I.; Kosho, T.; Wakui, K.; Sakazume, S.;
Ito, K.;
Matsuo, N.; Ohashi, H.; Nagai, T., Genetic evidence for a novel gene(s) involved in urogenital development on 10q26. Kidneylnt 2000, 58, (6), 2281-90.
4b. Ostrom, L.; Tang, M. J.; Grass, P.; Dressler, G. R., Reduced Pax2 gene dosage increases apoptosis and slows the progression of renal cystic disease. Dev Biol 2000, 219, (2), 250-8.
47. Mazal, P. R.; Stichenwirth, M.; Koller, A.; Blach, S.; Haitel, A.; Susani, M., Expression of aquaporins and PAX-2 compared to CD 10 and cytokeratin 7 in renal neoplasms: a tissue microarray study. Mod Pathol 2005, 18, (4), 535-40.
48. Buttiglieri, S.; Deregibus, M. C.; Bravo, S.; Cassoni, P.; Chiarle, R.;
Bussolati, B.;
Camussi, G., Role of Pax2 in apoptosis resistance and proinvasive phenotype of Kaposi's sarcoma cells. JBiol Chem 2004, 279, (6), 4136-43.
49. Gnarra, J. R.; Dressler, G. R., Expression of Pax-2 in human renal cell carcinoma and growth inhibition by antisense oligonucleotides. Cancer Res 1995, 55, (18), 4092-8.
50. Strasser, A., The role of BH3-only proteins in the immune system. Nat RevImmunol 2005, 5, (3), 189-200.
51. Lin, S.; Ying, S. Y., Differentially expressed genes in activin-induced apoptotic LNCaP cells. Bioclaem Biophys Res Comnaun 1999, 257, (1), 187-92.
52. Perfettini, J. L.; Kroemer, R. T.; Kroemer, G., Fatal liaisons of p53 with Bax and Bak. Nat Cell Biol 2004, 6, (5), 386-8.
53. Coultas, L.; Strasser, A., The role of the Bcl-2 protein family in cancer.
Semin Cancer Biol 2003, 13, (2), 115-23.
54. Margue, C. M.; Bernasconi, M.; Barr, F. G.; Schafer, B. W., Transcriptional modulation of the anti-apoptotic protein BCL-XL by the paired box transcription factors PAX3 and PAX3/FKHR. Oncogene 2000,19, (25), 2921-9.
55. Nakamura, Y., Isolation of p53-target genes and their functional analysis.
Cancer Sci 2004, 95, (1), 7-11.
56. Perfettini, J. L.; Roumier, T.; Kroemer, G., Mitochondrial fusion and fission in the control of apoptosis. Trends Cell Biol 2005, 15, (4), 179-83.
57. Orlando, V. Mapping chromosomal proteins in vivo by fonnaldehyde-crosslinked-chromatin immunoprecipitation. Trends Biochem Sci, 25: 99-104., 2000.
58. Boyd, K. E. and Farnham, P. J. Coexamination of site-specific transcription factor binding and promoter activity in living cells. Mol Cell Biol, 19: 8393-8399., 1999.
59. Wells, J. and Farnham, P. J. Characterizing transcription factor binding sites using formaldehyde crosslinking and immunoprecipitation. Methods, 26: 48-56., 2002.
60. Sikorski, R. S. and Hieter, P. A system of shuttle vectors and yeast host strains designed for efficient manipulation of DNA in Saccharomyces cerevisiae.
Genetics, 122:
19-27., 1989.
61. Nigro, J. M., Sikorski, R., Reed, S. I., and Vogelstein, B. Human p53 and CDC2Hs genes combine to inhibit the proliferation of Saccharomyces cerevisiae. Mol Cell Biol, 12:
1357-1365., 1992.
62. Wilson, T. E., Fahrner, T. J., Johnston, M., and Milbrandt, J.
Identification of the DNA binding site for NGFI-B by genetic selection in yeast. Science, 252: 1296-13 00., 1991.
63. Liu, J., Wilson, T. E., Milbrandt, J., and Johnsen, M. Identifying DNA-binding sites and analyzing DNA-binding domains using a yeast selection system. METHODS: A
companion to Methods in Enzymology, 5: 125-137, 1993.
64. Jackers, P., Szalai, G., and Watson, D. K. Ets-dependent regulation of target gene expression during megakaryopoiesis. in preparation, 2003.
It will be apparent to those skilled in the art that various modifications and variations can be made in the present invention without departing from the scope or spirit of the invention. Other embodiments of the invention will be apparent to those skilled in the art from consideration of the specification and practice of the invention disclosed herein. It is intended that the specification and examples be considered as exemplary only, with a true scope and spirit of the invention being indicated by the following claims.
Claims (11)
1. A method of treating cancer in a subject by inhibiting expression of PAX2.
2. The method of claim 1, wherein the method of inhibiting expression of PAX 2 is by administration of a nucleic acid encoding an siRNA for PAX 2.
3. The method of claim 2, wherein the siRNA is selected from the group consisting of:
AUAGACUCGACUUGACUUCUU (SEQ ID NO:2) AUCUUCAUCACGUUUCCUCUU (SEQ ID NO:4) GUAUUCAGCAAUCUUGUCCUU (SEQ ID NO:6) GAUUUGAUGUGCUCUGAUGUU (SEQ ID NO:8)
AUAGACUCGACUUGACUUCUU (SEQ ID NO:2) AUCUUCAUCACGUUUCCUCUU (SEQ ID NO:4) GUAUUCAGCAAUCUUGUCCUU (SEQ ID NO:6) GAUUUGAUGUGCUCUGAUGUU (SEQ ID NO:8)
4. The method of claim 2, wherein the cancer is prostate cancer.
5. A method of treating cancer in a subject by administering DEFB1.
6. A method of treating cancer in a subject by increasing expression of DEFB1 in the subject.
7. The method of claim 6, wherein the cancer is prostate cancer.
8. The method of claim 6, wherein the expression of DEFB1 is increased by blocking the binding of PAX2 to the DEFB1 promoter.
9. The method of claim 8, wherein the blocking of binding of PAX2 to the DEFB1 promoter is by administration of an oligonucleotide complementary to the PAX2 DNA
binding site of DEFB1.
binding site of DEFB1.
10. The method of claim 9, wherein the PAX2 DNA binding site of DEFB1 comprises SEQ ID NO:1 in forward or reverse orientation.
11. The method of claim 9, wherein the oligonucleotide complementary to the DNA binding site of DEFB1 is selected from the group consisting of X1GGAACX2, wherein X1 and X2 are 0 to 30 nucleotides complementary to nucleotides contiguous to SEQ ID NO:1 in the DEFB1 coding sequence.
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US72692105P | 2005-10-14 | 2005-10-14 | |
US60/726,921 | 2005-10-14 | ||
PCT/US2006/040215 WO2007047512A2 (en) | 2005-10-14 | 2006-10-16 | Inhibition of pax2 by defb1 induction as a therapy for cancer |
Publications (1)
Publication Number | Publication Date |
---|---|
CA2625891A1 true CA2625891A1 (en) | 2007-04-26 |
Family
ID=37963139
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CA002625891A Abandoned CA2625891A1 (en) | 2005-10-14 | 2006-10-16 | Inhibition of pax2 by defb1 induction as a therapy for cancer |
Country Status (5)
Country | Link |
---|---|
US (6) | US7964577B2 (en) |
EP (7) | EP2392645A1 (en) |
AU (1) | AU2006304321B2 (en) |
CA (1) | CA2625891A1 (en) |
WO (1) | WO2007047512A2 (en) |
Families Citing this family (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8080534B2 (en) * | 2005-10-14 | 2011-12-20 | Phigenix, Inc | Targeting PAX2 for the treatment of breast cancer |
US8461126B2 (en) | 2005-10-14 | 2013-06-11 | Phigenix, Inc. | Targeting EN2, PAX2, and/or DEFB1 for treatment of prostate conditions |
CA2667364A1 (en) * | 2007-01-16 | 2008-07-24 | Musc Foundation For Research Development | Compositions and methods for diagnosing, treating, and preventing prostate conditions |
CN104726593A (en) * | 2011-12-23 | 2015-06-24 | 上海吉凯基因化学技术有限公司 | Human NLK (nemo-like kinase) gene related use and related drugs |
CN103290016B (en) * | 2013-06-21 | 2015-04-22 | 厦门大学 | Branchiostoma belcheri Pax2/5/8 gene non-coding conservative element enhancer and application thereof |
WO2016090169A1 (en) * | 2014-12-03 | 2016-06-09 | Seed Research And Development Llc | Intracellular caspase probes for detection of apoptosis and inflammation and kits containing such probes |
KR101590452B1 (en) | 2015-05-20 | 2016-02-02 | 중앙대학교 산학협력단 | Pharmaceutical composition for enhancing immune response and preventing or treating cancer comprising peptide DEFB124 |
CN109908326A (en) * | 2018-09-14 | 2019-06-21 | 上海众择生物科技有限公司 | People's beta-alexin 1 is promoting the application in NK cell killing activity |
Family Cites Families (380)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CA678802A (en) | 1964-01-28 | J. Marino Frank | Portable loading canopy | |
US1159250A (en) * | 1914-05-01 | 1915-11-02 | Frank Moulton | Vaginal irrigator. |
US1666684A (en) * | 1926-01-15 | 1928-04-17 | Carstens Mfg Co H | Vaginal douche |
US1924972A (en) * | 1929-04-15 | 1933-08-29 | Carl J Beckert | Stabilized egg product |
US2085733A (en) * | 1935-07-15 | 1937-07-06 | John C Bird | Shaving cream |
US2390921A (en) * | 1943-03-23 | 1945-12-11 | Ethel Hudson Clark | Applicator for facial creams |
US2524590A (en) * | 1946-04-22 | 1950-10-03 | Carsten F Boe | Emulsion containing a liquefied propellant gas under pressure and method of spraying same |
US2586287A (en) * | 1948-12-11 | 1952-02-19 | Colagte Palmolive Peet Company | Aluminum sulfamate antiperspirant preparation |
US2617754A (en) * | 1949-08-29 | 1952-11-11 | Procter & Gamble | Cosmetic cream |
US3062715A (en) * | 1953-11-18 | 1962-11-06 | George S Pfaus | Vaginal tablet |
US2767712A (en) * | 1954-03-01 | 1956-10-23 | Neil S Waterman | Medicinal applicator |
US3092555A (en) * | 1958-04-21 | 1963-06-04 | Roy H Horn | Relatively collapsible aerosol foam compositions |
US3144386A (en) * | 1958-05-09 | 1964-08-11 | Merck & Co Inc | Mastitis aerosol foam |
US2968628A (en) * | 1958-10-17 | 1961-01-17 | Shulton Inc | Propellant composition |
US3178352A (en) * | 1959-02-27 | 1965-04-13 | Erickson Roy | Shaving method and composition therefor |
US3141821A (en) * | 1959-03-17 | 1964-07-21 | Lehn & Fink Products Corp | Synergistic combination of alkyl sulfonates, alkylaryl sulfonates and topical antibacterial agents for local antisepsis |
US3004894A (en) * | 1959-04-07 | 1961-10-17 | Upjohn Co | Therapeutic composition comprising tetracycline and a dioxolane |
US3142420A (en) * | 1959-11-09 | 1964-07-28 | Neotechnic Eng Ltd | Metering dispenser for aerosol with fluid pressure operated piston |
US3092255A (en) * | 1960-02-05 | 1963-06-04 | Robert F Hohman | Sorting apparatus |
US3067784A (en) * | 1960-04-14 | 1962-12-11 | Esta Medical Lab Inc | Adapter connecting aerosol container valve stem to dispenser for filling said dispenser |
US3154075A (en) * | 1960-11-02 | 1964-10-27 | Norwich Pharma Co | Vaginal applicator |
US3261695A (en) * | 1962-12-24 | 1966-07-19 | Gen Foods Corp | Process for preparing dehydrated foods |
US3330730A (en) * | 1962-08-03 | 1967-07-11 | Colgate Palmolive Co | Pressurized emulsion quick breaking foam compositions |
US3252859A (en) * | 1962-10-24 | 1966-05-24 | Masti Kure Company Inc | Colloidal silica-oil composition and method of using same |
US3244589A (en) * | 1962-10-26 | 1966-04-05 | Sunnen | Alkyl phenoxy polyethoxy ether spermicidal aerosol |
US3298919A (en) * | 1962-12-26 | 1967-01-17 | Dow Corning | Shaving cream containing polysiloxanes |
US3149543A (en) * | 1963-03-04 | 1964-09-22 | Ingersoll Rand Co | Non-lubricated piston |
GB1026831A (en) * | 1963-05-31 | 1966-04-20 | Mediline Ag | Preparations for use in feminine hygiene |
US3333333A (en) * | 1963-08-14 | 1967-08-01 | Rca Corp | Method of making magnetic material with pattern of embedded non-magnetic material |
US3236457A (en) * | 1963-08-21 | 1966-02-22 | John R Kennedy | Composite spray container assembly |
US3263867A (en) * | 1963-12-26 | 1966-08-02 | Valve Corp Of America | Metering button-type aerosol actuator |
US3395214A (en) * | 1964-01-09 | 1968-07-30 | Scholl Mfg Co Inc | Antiperspirant composition providing a readily collapsible sprayable foam |
GB1052724A (en) * | 1964-04-27 | |||
US3303970A (en) * | 1964-07-14 | 1967-02-14 | Jerome Marrow | Device for simultaneously dispensing from plural sources |
US3395215A (en) * | 1964-10-15 | 1968-07-30 | Colgate Palmolive Co | Pressurized lotion composition |
US3384541A (en) * | 1964-10-28 | 1968-05-21 | William G. Clark | Spermicidal vaginal pharmaceutical concentrate for producing nonaqueous foam with aerosol propellants |
US3263869A (en) * | 1964-11-03 | 1966-08-02 | Calmar Inc | Liquid dispenser with overcap |
US3419658A (en) * | 1965-01-25 | 1968-12-31 | Du Pont | Nonaqueous aerosol foams containing mineral oil |
US3346451A (en) * | 1965-01-27 | 1967-10-10 | S E Massengill Company | Concentrated liquid lactic acid douche preparation containing aromatics |
US3301444A (en) * | 1965-08-12 | 1967-01-31 | Oel Inc | Aerosol metering valve |
US3456052A (en) * | 1965-09-28 | 1969-07-15 | Garrett Lab Inc | Aerosol composition containing butoxymonoether of a polyoxyalkylene glycol |
US3401849A (en) * | 1966-05-24 | 1968-09-17 | Robert L. Weber | Low force metering valve |
US3377004A (en) * | 1966-10-03 | 1968-04-09 | Gen Mills Inc | Metered dispensing container |
US3527559A (en) * | 1967-01-05 | 1970-09-08 | Standard Pharmacal Corp | Dense aqueous aerosol foam depilatory compositions containing a mixture of alkaline metal and alkali metal thioglycolates and a fatty alcohol-alkylene oxide wax emulsifying agent |
US3366494A (en) * | 1967-02-15 | 1968-01-30 | Du Pont | Pressurized aerosol food emulsions |
US3561262A (en) * | 1967-10-26 | 1971-02-09 | Magnaflux Corp | Water soluble developer |
US3540448A (en) * | 1968-01-17 | 1970-11-17 | Joseph Sunnen | Rechargeable applicator for dispensing substances in a foam condition |
US3563098A (en) * | 1968-06-28 | 1971-02-16 | Rex Chainbelt Inc | Automatic quick release mechanism |
US3559890A (en) * | 1968-09-03 | 1971-02-02 | William R Brooks | Foam dispenser |
FR1601438A (en) | 1968-10-17 | 1970-08-24 | ||
US3667461A (en) * | 1968-11-05 | 1972-06-06 | Paul A Zamarra | Disposable syringe |
US3819524A (en) * | 1969-06-17 | 1974-06-25 | Colgate Palmolive Co | Cosmetic composition for thermal dispensing |
US3577518A (en) * | 1969-07-18 | 1971-05-04 | Nat Patent Dev Corp | Hydrophilic hairspray and hair setting preparations |
US3787566A (en) * | 1969-07-29 | 1974-01-22 | Holliston Labor Inc | Disinfecting aerosol compositions |
US3687808A (en) | 1969-08-14 | 1972-08-29 | Univ Leland Stanford Junior | Synthetic polynucleotides |
US3770648A (en) * | 1971-07-12 | 1973-11-06 | Bristol Myers Co | Anhydrous aerosol foam |
US3751562A (en) * | 1972-09-22 | 1973-08-07 | Princeton Biomedix | Medicated gelled oils |
NO812612L (en) | 1980-08-06 | 1982-02-08 | Ferring Pharma Ltd | ENZYME inhibitor. |
US4469863A (en) | 1980-11-12 | 1984-09-04 | Ts O Paul O P | Nonionic nucleic acid alkyl and aryl phosphonates and processes for manufacture and use thereof |
US5023243A (en) | 1981-10-23 | 1991-06-11 | Molecular Biosystems, Inc. | Oligonucleotide therapeutic agent and method of making same |
US4476301A (en) | 1982-04-29 | 1984-10-09 | Centre National De La Recherche Scientifique | Oligonucleotides, a process for preparing the same and their application as mediators of the action of interferon |
JPS5927900A (en) | 1982-08-09 | 1984-02-14 | Wakunaga Seiyaku Kk | Oligonucleotide derivative and its preparation |
FR2540122B1 (en) | 1983-01-27 | 1985-11-29 | Centre Nat Rech Scient | NOVEL COMPOUNDS COMPRISING A SEQUENCE OF OLIGONUCLEOTIDE LINKED TO AN INTERCALATION AGENT, THEIR SYNTHESIS PROCESS AND THEIR APPLICATION |
US4605735A (en) | 1983-02-14 | 1986-08-12 | Wakunaga Seiyaku Kabushiki Kaisha | Oligonucleotide derivatives |
US4948882A (en) | 1983-02-22 | 1990-08-14 | Syngene, Inc. | Single-stranded labelled oligonucleotides, reactive monomers and methods of synthesis |
US4824941A (en) | 1983-03-10 | 1989-04-25 | Julian Gordon | Specific antibody to the native form of 2'5'-oligonucleotides, the method of preparation and the use as reagents in immunoassays or for binding 2'5'-oligonucleotides in biological systems |
US4587044A (en) | 1983-09-01 | 1986-05-06 | The Johns Hopkins University | Linkage of proteins to nucleic acids |
US5118800A (en) | 1983-12-20 | 1992-06-02 | California Institute Of Technology | Oligonucleotides possessing a primary amino group in the terminal nucleotide |
US5118802A (en) | 1983-12-20 | 1992-06-02 | California Institute Of Technology | DNA-reporter conjugates linked via the 2' or 5'-primary amino group of the 5'-terminal nucleoside |
US5550111A (en) | 1984-07-11 | 1996-08-27 | Temple University-Of The Commonwealth System Of Higher Education | Dual action 2',5'-oligoadenylate antiviral derivatives and uses thereof |
FR2567892B1 (en) | 1984-07-19 | 1989-02-17 | Centre Nat Rech Scient | NOVEL OLIGONUCLEOTIDES, THEIR PREPARATION PROCESS AND THEIR APPLICATIONS AS MEDIATORS IN DEVELOPING THE EFFECTS OF INTERFERONS |
US5430136A (en) | 1984-10-16 | 1995-07-04 | Chiron Corporation | Oligonucleotides having selectably cleavable and/or abasic sites |
US5367066A (en) | 1984-10-16 | 1994-11-22 | Chiron Corporation | Oligonucleotides with selectably cleavable and/or abasic sites |
US5258506A (en) | 1984-10-16 | 1993-11-02 | Chiron Corporation | Photolabile reagents for incorporation into oligonucleotide chains |
US4828979A (en) | 1984-11-08 | 1989-05-09 | Life Technologies, Inc. | Nucleotide analogs for nucleic acid labeling and detection |
US4897355A (en) | 1985-01-07 | 1990-01-30 | Syntex (U.S.A.) Inc. | N[ω,(ω-1)-dialkyloxy]- and N-[ω,(ω-1)-dialkenyloxy]-alk-1-yl-N,N,N-tetrasubstituted ammonium lipids and uses therefor |
FR2575751B1 (en) | 1985-01-08 | 1987-04-03 | Pasteur Institut | NOVEL ADENOSINE DERIVATIVE NUCLEOSIDES, THEIR PREPARATION AND THEIR BIOLOGICAL APPLICATIONS |
US5034506A (en) | 1985-03-15 | 1991-07-23 | Anti-Gene Development Group | Uncharged morpholino-based polymers having achiral intersubunit linkages |
US5166315A (en) | 1989-12-20 | 1992-11-24 | Anti-Gene Development Group | Sequence-specific binding polymers for duplex nucleic acids |
US5405938A (en) | 1989-12-20 | 1995-04-11 | Anti-Gene Development Group | Sequence-specific binding polymers for duplex nucleic acids |
US5185444A (en) | 1985-03-15 | 1993-02-09 | Anti-Gene Deveopment Group | Uncharged morpolino-based polymers having phosphorous containing chiral intersubunit linkages |
US5235033A (en) | 1985-03-15 | 1993-08-10 | Anti-Gene Development Group | Alpha-morpholino ribonucleoside derivatives and polymers thereof |
US5506337A (en) | 1985-03-15 | 1996-04-09 | Antivirals Inc. | Morpholino-subunit combinatorial library and method |
US4762779A (en) | 1985-06-13 | 1988-08-09 | Amgen Inc. | Compositions and methods for functionalizing nucleic acids |
DE3681787D1 (en) | 1985-07-05 | 1991-11-07 | Whitehead Biomedical Inst | EXPRESSION OF FOREIGN GENETIC MATERIAL IN EPITHELIC CELLS. |
US4980286A (en) | 1985-07-05 | 1990-12-25 | Whitehead Institute For Biomedical Research | In vivo introduction and expression of foreign genetic material in epithelial cells |
US5317098A (en) | 1986-03-17 | 1994-05-31 | Hiroaki Shizuya | Non-radioisotope tagging of fragments |
JPS638396A (en) | 1986-06-30 | 1988-01-14 | Wakunaga Pharmaceut Co Ltd | Poly-labeled oligonucleotide derivative |
US5834185A (en) | 1986-10-28 | 1998-11-10 | Johns Hopkins University | Formation of triple helix complexes of single stranded nucleic acids using nucleoside oligomers which comprise pyrimidine analogs, triple helix complexes formed thereby and oligomers used in their formation |
US5264423A (en) | 1987-03-25 | 1993-11-23 | The United States Of America As Represented By The Department Of Health And Human Services | Inhibitors for replication of retroviruses and for the expression of oncogene products |
US5276019A (en) | 1987-03-25 | 1994-01-04 | The United States Of America As Represented By The Department Of Health And Human Services | Inhibitors for replication of retroviruses and for the expression of oncogene products |
US4904582A (en) | 1987-06-11 | 1990-02-27 | Synthetic Genetics | Novel amphiphilic nucleic acid conjugates |
EP0366685B1 (en) | 1987-06-24 | 1994-10-19 | Howard Florey Institute Of Experimental Physiology And Medicine | Nucleoside derivatives |
US5585481A (en) | 1987-09-21 | 1996-12-17 | Gen-Probe Incorporated | Linking reagents for nucleotide probes |
US5188897A (en) | 1987-10-22 | 1993-02-23 | Temple University Of The Commonwealth System Of Higher Education | Encapsulated 2',5'-phosphorothioate oligoadenylates |
US4924624A (en) | 1987-10-22 | 1990-05-15 | Temple University-Of The Commonwealth System Of Higher Education | 2,',5'-phosphorothioate oligoadenylates and plant antiviral uses thereof |
US5525465A (en) | 1987-10-28 | 1996-06-11 | Howard Florey Institute Of Experimental Physiology And Medicine | Oligonucleotide-polyamide conjugates and methods of production and applications of the same |
DE3738460A1 (en) | 1987-11-12 | 1989-05-24 | Max Planck Gesellschaft | MODIFIED OLIGONUCLEOTIDS |
WO1989007136A2 (en) | 1988-02-05 | 1989-08-10 | Whitehead Institute For Biomedical Research | Modified hepatocytes and uses therefor |
US5082830A (en) | 1988-02-26 | 1992-01-21 | Enzo Biochem, Inc. | End labeled nucleotide probe |
JPH03503894A (en) | 1988-03-25 | 1991-08-29 | ユニバーシィティ オブ バージニア アランミ パテンツ ファウンデイション | Oligonucleotide N-alkylphosphoramidate |
US5278302A (en) | 1988-05-26 | 1994-01-11 | University Patents, Inc. | Polynucleotide phosphorodithioates |
US5109124A (en) | 1988-06-01 | 1992-04-28 | Biogen, Inc. | Nucleic acid probe linked to a label having a terminal cysteine |
US5216141A (en) | 1988-06-06 | 1993-06-01 | Benner Steven A | Oligonucleotide analogs containing sulfur linkages |
US5175273A (en) | 1988-07-01 | 1992-12-29 | Genentech, Inc. | Nucleic acid intercalating agents |
US5294533A (en) | 1988-07-05 | 1994-03-15 | Baylor College Of Medicine | Antisense oligonucleotide antibiotics complementary to the macromolecular synthesis operon, methods of treating bacterial infections and methods for identification of bacteria |
CA1339354C (en) | 1988-09-01 | 1997-08-26 | The Whitehead Institute For Biomedical Research | Recombinant retroviruses with amphotropic and ecotropic host ranges |
US5262536A (en) | 1988-09-15 | 1993-11-16 | E. I. Du Pont De Nemours And Company | Reagents for the preparation of 5'-tagged oligonucleotides |
US5866701A (en) | 1988-09-20 | 1999-02-02 | The Board Of Regents For Northern Illinois University Of Dekalb | HIV targeted hairpin ribozymes |
US5512439A (en) | 1988-11-21 | 1996-04-30 | Dynal As | Oligonucleotide-linked magnetic particles and uses thereof |
US5176996A (en) | 1988-12-20 | 1993-01-05 | Baylor College Of Medicine | Method for making synthetic oligonucleotides which bind specifically to target sites on duplex DNA molecules, by forming a colinear triplex, the synthetic oligonucleotides and methods of use |
US5599923A (en) | 1989-03-06 | 1997-02-04 | Board Of Regents, University Of Tx | Texaphyrin metal complexes having improved functionalization |
US5457183A (en) | 1989-03-06 | 1995-10-10 | Board Of Regents, The University Of Texas System | Hydroxylated texaphyrins |
US5624824A (en) | 1989-03-24 | 1997-04-29 | Yale University | Targeted cleavage of RNA using eukaryotic ribonuclease P and external guide sequence |
US5168053A (en) | 1989-03-24 | 1992-12-01 | Yale University | Cleavage of targeted RNA by RNAase P |
US5391723A (en) | 1989-05-31 | 1995-02-21 | Neorx Corporation | Oligonucleotide conjugates |
US4958013A (en) | 1989-06-06 | 1990-09-18 | Northwestern University | Cholesteryl modified oligonucleotides |
US6020145A (en) * | 1989-06-30 | 2000-02-01 | Bristol-Myers Squibb Company | Methods for determining the presence of carcinoma using the antigen binding region of monoclonal antibody BR96 |
US5451463A (en) | 1989-08-28 | 1995-09-19 | Clontech Laboratories, Inc. | Non-nucleoside 1,3-diol reagents for labeling synthetic oligonucleotides |
US5134066A (en) | 1989-08-29 | 1992-07-28 | Monsanto Company | Improved probes using nucleosides containing 3-dezauracil analogs |
US5254469A (en) | 1989-09-12 | 1993-10-19 | Eastman Kodak Company | Oligonucleotide-enzyme conjugate that can be used as a probe in hybridization assays and polymerase chain reaction procedures |
US5591722A (en) | 1989-09-15 | 1997-01-07 | Southern Research Institute | 2'-deoxy-4'-thioribonucleosides and their antiviral activity |
US5399676A (en) | 1989-10-23 | 1995-03-21 | Gilead Sciences | Oligonucleotides with inverted polarity |
ATE190981T1 (en) | 1989-10-24 | 2000-04-15 | Isis Pharmaceuticals Inc | 2'-MODIFIED NUCLEOTIDES |
US5264564A (en) | 1989-10-24 | 1993-11-23 | Gilead Sciences | Oligonucleotide analogs with novel linkages |
US5264562A (en) | 1989-10-24 | 1993-11-23 | Gilead Sciences, Inc. | Oligonucleotide analogs with novel linkages |
US5292873A (en) | 1989-11-29 | 1994-03-08 | The Research Foundation Of State University Of New York | Nucleic acids labeled with naphthoquinone probe |
US5177198A (en) | 1989-11-30 | 1993-01-05 | University Of N.C. At Chapel Hill | Process for preparing oligoribonucleoside and oligodeoxyribonucleoside boranophosphates |
JP2507895B2 (en) | 1989-12-19 | 1996-06-19 | 工業技術院長 | New synthesis system of ribozyme |
US5130302A (en) | 1989-12-20 | 1992-07-14 | Boron Bilogicals, Inc. | Boronated nucleoside, nucleotide and oligonucleotide compounds, compositions and methods for using same |
US5486603A (en) | 1990-01-08 | 1996-01-23 | Gilead Sciences, Inc. | Oligonucleotide having enhanced binding affinity |
US5681941A (en) | 1990-01-11 | 1997-10-28 | Isis Pharmaceuticals, Inc. | Substituted purines and oligonucleotide cross-linking |
US5646265A (en) | 1990-01-11 | 1997-07-08 | Isis Pharmceuticals, Inc. | Process for the preparation of 2'-O-alkyl purine phosphoramidites |
US5578718A (en) | 1990-01-11 | 1996-11-26 | Isis Pharmaceuticals, Inc. | Thiol-derivatized nucleosides |
US5587361A (en) | 1991-10-15 | 1996-12-24 | Isis Pharmaceuticals, Inc. | Oligonucleotides having phosphorothioate linkages of high chiral purity |
US5459255A (en) | 1990-01-11 | 1995-10-17 | Isis Pharmaceuticals, Inc. | N-2 substituted purines |
US5670633A (en) | 1990-01-11 | 1997-09-23 | Isis Pharmaceuticals, Inc. | Sugar modified oligonucleotides that detect and modulate gene expression |
US5214136A (en) | 1990-02-20 | 1993-05-25 | Gilead Sciences, Inc. | Anthraquinone-derivatives oligonucleotides |
AU7579991A (en) | 1990-02-20 | 1991-09-18 | Gilead Sciences, Inc. | Pseudonucleosides and pseudonucleotides and their polymers |
US5321131A (en) | 1990-03-08 | 1994-06-14 | Hybridon, Inc. | Site-specific functionalization of oligodeoxynucleotides for non-radioactive labelling |
US5084824A (en) | 1990-03-29 | 1992-01-28 | National Semiconductor Corporation | Simulation model generation from a physical data base of a combinatorial circuit |
US5470967A (en) | 1990-04-10 | 1995-11-28 | The Dupont Merck Pharmaceutical Company | Oligonucleotide analogs with sulfamate linkages |
GB9009980D0 (en) | 1990-05-03 | 1990-06-27 | Amersham Int Plc | Phosphoramidite derivatives,their preparation and the use thereof in the incorporation of reporter groups on synthetic oligonucleotides |
ATE167523T1 (en) | 1990-05-11 | 1998-07-15 | Microprobe Corp | IMMERSIBLE TEST STRIPS FOR NUCLEIC ACID HYBRIDIZATION ASSAY AND METHOD FOR COVALENT IMMOBILIZATION OF OLIGONUCLEOTIDES |
US5780228A (en) | 1990-06-11 | 1998-07-14 | Nexstar Pharmaceuticals, Inc. | High affinity nucleic acid ligands to lectins |
US6001988A (en) | 1990-06-11 | 1999-12-14 | Nexstar Pharmaceuticals, Inc. | High affinity nucleic acid ligands to lectins |
US5660985A (en) | 1990-06-11 | 1997-08-26 | Nexstar Pharmaceuticals, Inc. | High affinity nucleic acid ligands containing modified nucleotides |
US6011020A (en) | 1990-06-11 | 2000-01-04 | Nexstar Pharmaceuticals, Inc. | Nucleic acid ligand complexes |
US5795721A (en) | 1990-06-11 | 1998-08-18 | Nexstar Pharmaceuticals, Inc. | High affinity nucleic acid ligands of ICP4 |
US5723289A (en) | 1990-06-11 | 1998-03-03 | Nexstar Pharmaceuticals, Inc. | Parallel selex |
US5476766A (en) | 1990-06-11 | 1995-12-19 | Nexstar Pharmaceuticals, Inc. | Ligands of thrombin |
US5846713A (en) | 1990-06-11 | 1998-12-08 | Nexstar Pharmaceuticals, Inc. | High affinity HKGF nucleic acid ligands and inhibitors |
US5861254A (en) | 1997-01-31 | 1999-01-19 | Nexstar Pharmaceuticals, Inc. | Flow cell SELEX |
US5864026A (en) | 1990-06-11 | 1999-01-26 | Nexstar Pharmaceuticals, Inc. | Systematic evolution of ligands by exponential enrichment: tissue selex |
US5580737A (en) | 1990-06-11 | 1996-12-03 | Nexstar Pharmaceuticals, Inc. | High-affinity nucleic acid ligands that discriminate between theophylline and caffeine |
US5731424A (en) | 1990-06-11 | 1998-03-24 | Nexstar Pharmaceuticals, Inc. | High affinity TGFβ nucleic acid ligands and inhibitors |
US5543293A (en) | 1990-06-11 | 1996-08-06 | Nexstar Pharmaceuticals, Inc. | DNA ligands of thrombin |
US5869641A (en) | 1990-06-11 | 1999-02-09 | Nexstar Pharmaceuticals, Inc. | High affinity nucleic acid ligands of CD4 |
US6030776A (en) | 1990-06-11 | 2000-02-29 | Nexstar Pharmaceuticals, Inc. | Parallel SELEX |
US5503978A (en) | 1990-06-11 | 1996-04-02 | University Research Corporation | Method for identification of high affinity DNA ligands of HIV-1 reverse transcriptase |
US5135917A (en) | 1990-07-12 | 1992-08-04 | Nova Pharmaceutical Corporation | Interleukin receptor expression inhibiting antisense oligonucleotides |
US5688941A (en) | 1990-07-27 | 1997-11-18 | Isis Pharmaceuticals, Inc. | Methods of making conjugated 4' desmethyl nucleoside analog compounds |
US5618704A (en) | 1990-07-27 | 1997-04-08 | Isis Pharmacueticals, Inc. | Backbone-modified oligonucleotide analogs and preparation thereof through radical coupling |
US5602240A (en) | 1990-07-27 | 1997-02-11 | Ciba Geigy Ag. | Backbone modified oligonucleotide analogs |
US5610289A (en) | 1990-07-27 | 1997-03-11 | Isis Pharmaceuticals, Inc. | Backbone modified oligonucleotide analogues |
US5138045A (en) | 1990-07-27 | 1992-08-11 | Isis Pharmaceuticals | Polyamine conjugated oligonucleotides |
US5489677A (en) | 1990-07-27 | 1996-02-06 | Isis Pharmaceuticals, Inc. | Oligonucleoside linkages containing adjacent oxygen and nitrogen atoms |
US5541307A (en) | 1990-07-27 | 1996-07-30 | Isis Pharmaceuticals, Inc. | Backbone modified oligonucleotide analogs and solid phase synthesis thereof |
US5623070A (en) | 1990-07-27 | 1997-04-22 | Isis Pharmaceuticals, Inc. | Heteroatomic oligonucleoside linkages |
ATE154246T1 (en) | 1990-07-27 | 1997-06-15 | Isis Pharmaceuticals Inc | NUCLEASE RESISTANT PYRIMIDINE MODIFIED OLIGONUCLEOTIDES THAT DETECTE AND MODULATE GENE EXPRESSION |
US5608046A (en) | 1990-07-27 | 1997-03-04 | Isis Pharmaceuticals, Inc. | Conjugated 4'-desmethyl nucleoside analog compounds |
US5677437A (en) | 1990-07-27 | 1997-10-14 | Isis Pharmaceuticals, Inc. | Heteroatomic oligonucleoside linkages |
US5218105A (en) | 1990-07-27 | 1993-06-08 | Isis Pharmaceuticals | Polyamine conjugated oligonucleotides |
US5245022A (en) | 1990-08-03 | 1993-09-14 | Sterling Drug, Inc. | Exonuclease resistant terminally substituted oligonucleotides |
WO1992002534A2 (en) | 1990-08-03 | 1992-02-20 | Sterling Drug, Inc. | Compounds and methods for inhibiting gene expression |
US5177196A (en) | 1990-08-16 | 1993-01-05 | Microprobe Corporation | Oligo (α-arabinofuranosyl nucleotides) and α-arabinofuranosyl precursors thereof |
US5512667A (en) | 1990-08-28 | 1996-04-30 | Reed; Michael W. | Trifunctional intermediates for preparing 3'-tailed oligonucleotides |
US5214134A (en) | 1990-09-12 | 1993-05-25 | Sterling Winthrop Inc. | Process of linking nucleosides with a siloxane bridge |
US5561225A (en) | 1990-09-19 | 1996-10-01 | Southern Research Institute | Polynucleotide analogs containing sulfonate and sulfonamide internucleoside linkages |
JPH06505704A (en) | 1990-09-20 | 1994-06-30 | ギリアド サイエンシズ,インコーポレイテッド | Modified internucleoside linkages |
US5432272A (en) | 1990-10-09 | 1995-07-11 | Benner; Steven A. | Method for incorporating into a DNA or RNA oligonucleotide using nucleotides bearing heterocyclic bases |
US5271941A (en) | 1990-11-02 | 1993-12-21 | Cho Chung Yoon S | Antisense oligonucleotides of human regulatory subunit RI.sub.α of cAMP-dependent protein kinases |
KR930702373A (en) | 1990-11-08 | 1993-09-08 | 안토니 제이. 페이네 | Addition of Multiple Reporter Groups to Synthetic Oligonucleotides |
DE69130831T2 (en) | 1990-11-21 | 1999-09-16 | Iterex Pharma Lp | SYNTHESIS OF EQUIMOLAR MIXTURES OF VARIOUS OLIGOMERS, SPECIALLY OLIGOPEPTIDE MIXTURES |
US5683874A (en) | 1991-03-27 | 1997-11-04 | Research Corporation Technologies, Inc. | Single-stranded circular oligonucleotides capable of forming a triplex with a target sequence |
US5539082A (en) | 1993-04-26 | 1996-07-23 | Nielsen; Peter E. | Peptide nucleic acids |
US5719262A (en) | 1993-11-22 | 1998-02-17 | Buchardt, Deceased; Ole | Peptide nucleic acids having amino acid side chains |
US5714331A (en) | 1991-05-24 | 1998-02-03 | Buchardt, Deceased; Ole | Peptide nucleic acids having enhanced binding affinity, sequence specificity and solubility |
US6028186A (en) | 1991-06-10 | 2000-02-22 | Nexstar Pharmaceuticals, Inc. | High affinity nucleic acid ligands of cytokines |
DE4216134A1 (en) | 1991-06-20 | 1992-12-24 | Europ Lab Molekularbiolog | SYNTHETIC CATALYTIC OLIGONUCLEOTIDE STRUCTURES |
US5371241A (en) | 1991-07-19 | 1994-12-06 | Pharmacia P-L Biochemicals Inc. | Fluorescein labelled phosphoramidites |
US5449754A (en) | 1991-08-07 | 1995-09-12 | H & N Instruments, Inc. | Generation of combinatorial libraries |
US5571799A (en) | 1991-08-12 | 1996-11-05 | Basco, Ltd. | (2'-5') oligoadenylate analogues useful as inhibitors of host-v5.-graft response |
US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
DE59208572D1 (en) | 1991-10-17 | 1997-07-10 | Ciba Geigy Ag | Bicyclic nucleosides, oligonucleotides, processes for their preparation and intermediates |
US5594121A (en) | 1991-11-07 | 1997-01-14 | Gilead Sciences, Inc. | Enhanced triple-helix and double-helix formation with oligomers containing modified purines |
US6261834B1 (en) | 1991-11-08 | 2001-07-17 | Research Corporation Technologies, Inc. | Vector for gene therapy |
US5677195A (en) | 1991-11-22 | 1997-10-14 | Affymax Technologies N.V. | Combinatorial strategies for polymer synthesis |
US5484908A (en) | 1991-11-26 | 1996-01-16 | Gilead Sciences, Inc. | Oligonucleotides containing 5-propynyl pyrimidines |
ATE226093T1 (en) | 1991-11-26 | 2002-11-15 | Isis Pharmaceuticals Inc | INCREASED FORMATION OF TRIPLE AND DOUBLE HELICES FROM OLIGOMERS WITH MODIFIED PYRIMIDINES |
US5359044A (en) | 1991-12-13 | 1994-10-25 | Isis Pharmaceuticals | Cyclobutyl oligonucleotide surrogates |
US5596079A (en) | 1991-12-16 | 1997-01-21 | Smith; James R. | Mimetics of senescent cell derived inhibitors of DNA synthesis |
US5595726A (en) | 1992-01-21 | 1997-01-21 | Pharmacyclics, Inc. | Chromophore probe for detection of nucleic acid |
US5565552A (en) | 1992-01-21 | 1996-10-15 | Pharmacyclics, Inc. | Method of expanded porphyrin-oligonucleotide conjugate synthesis |
US5652094A (en) | 1992-01-31 | 1997-07-29 | University Of Montreal | Nucleozymes |
FR2687679B1 (en) | 1992-02-05 | 1994-10-28 | Centre Nat Rech Scient | OLIGOTHIONUCLEOTIDES. |
US5573905A (en) | 1992-03-30 | 1996-11-12 | The Scripps Research Institute | Encoded combinatorial chemical libraries |
US5633360A (en) | 1992-04-14 | 1997-05-27 | Gilead Sciences, Inc. | Oligonucleotide analogs capable of passive cell membrane permeation |
WO1993022434A2 (en) | 1992-04-28 | 1993-11-11 | Yale University | Targeted cleavage of rna using eukaryotic ribonuclease p and external guide sequence |
US5646020A (en) | 1992-05-14 | 1997-07-08 | Ribozyme Pharmaceuticals, Inc. | Hammerhead ribozymes for preferred targets |
US5972699A (en) | 1992-05-14 | 1999-10-26 | Ribozyme Pharmaceuticals, Inc. | Method and reagent for inhibiting herpes simplex virus replication |
US5989906A (en) | 1992-05-14 | 1999-11-23 | Ribozyme Pharmaceuticals, Inc. | Method and reagent for inhibiting P-glycoprotein (mdr-1-gene) |
US5693535A (en) | 1992-05-14 | 1997-12-02 | Ribozyme Pharmaceuticals, Inc. | HIV targeted ribozymes |
US6017756A (en) | 1992-05-14 | 2000-01-25 | Ribozyme Pharmaceuticals, Inc. | Method and reagent for inhibiting hepatitis B virus replication |
US5610054A (en) | 1992-05-14 | 1997-03-11 | Ribozyme Pharmaceuticals, Inc. | Enzymatic RNA molecule targeted against Hepatitis C virus |
US5434257A (en) | 1992-06-01 | 1995-07-18 | Gilead Sciences, Inc. | Binding compentent oligomers containing unsaturated 3',5' and 2',5' linkages |
EP0577558A2 (en) | 1992-07-01 | 1994-01-05 | Ciba-Geigy Ag | Carbocyclic nucleosides having bicyclic rings, oligonucleotides therefrom, process for their preparation, their use and intermediates |
AU672018B2 (en) | 1992-07-02 | 1996-09-19 | Sankyo Company Limited | Looped, hairpin ribozyme |
US5272250A (en) | 1992-07-10 | 1993-12-21 | Spielvogel Bernard F | Boronated phosphoramidate compounds |
US5288314A (en) | 1992-08-04 | 1994-02-22 | Crescent Manufacturing | Polish |
US5646042A (en) | 1992-08-26 | 1997-07-08 | Ribozyme Pharmaceuticals, Inc. | C-myb targeted ribozymes |
US5288514A (en) | 1992-09-14 | 1994-02-22 | The Regents Of The University Of California | Solid phase and combinatorial synthesis of benzodiazepine compounds on a solid support |
US5565324A (en) | 1992-10-01 | 1996-10-15 | The Trustees Of Columbia University In The City Of New York | Complex combinatorial chemical libraries encoded with tags |
US5721099A (en) | 1992-10-01 | 1998-02-24 | Trustees Of Columbia University In The City Of New York | Complex combinatorial chemical libraries encoded with tags |
US5891684A (en) | 1992-10-15 | 1999-04-06 | Ribozyme Pharmaceuticals, Inc. | Base-modified enzymatic nucleic acid |
US5807683A (en) | 1992-11-19 | 1998-09-15 | Combichem, Inc. | Combinatorial libraries and methods for their use |
US5612215A (en) | 1992-12-07 | 1997-03-18 | Ribozyme Pharmaceuticals, Inc. | Stromelysin targeted ribozymes |
US5811300A (en) | 1992-12-07 | 1998-09-22 | Ribozyme Pharmaceuticals, Inc. | TNF-α ribozymes |
US5574142A (en) | 1992-12-15 | 1996-11-12 | Microprobe Corporation | Peptide linkers for improved oligonucleotide delivery |
JPH08505531A (en) | 1993-01-15 | 1996-06-18 | ザ パブリック ヘルス リサーチ インスティチュート オブ ザ シティー オブ ニューヨーク インク | RNA assay method using RNA binary probe and ribozyme ligase |
US5786138A (en) | 1993-01-29 | 1998-07-28 | Board Of Supervisors Of Louisiana State University And Agricultural And Mechanical College | Hyperstabilizing antisense nucleic acid binding agents |
US5476925A (en) | 1993-02-01 | 1995-12-19 | Northwestern University | Oligodeoxyribonucleotides including 3'-aminonucleoside-phosphoramidate linkages and terminal 3'-amino groups |
GB9304618D0 (en) | 1993-03-06 | 1993-04-21 | Ciba Geigy Ag | Chemical compounds |
CA2159631A1 (en) | 1993-03-30 | 1994-10-13 | Sanofi | Acyclic nucleoside analogs and oligonucleotide sequences containing them |
CA2159629A1 (en) | 1993-03-31 | 1994-10-13 | Sanofi | Oligonucleotides with amide linkages replacing phosphodiester linkages |
DE4311944A1 (en) | 1993-04-10 | 1994-10-13 | Degussa | Coated sodium percarbonate particles, process for their preparation and detergent, cleaning and bleaching compositions containing them |
ATE196313T1 (en) | 1993-06-04 | 2000-09-15 | Us Health | METHOD FOR TREATING KAPOSI-SARCOMA WITH ANTISENSE OLIGONUCLEOTIDES |
US5962426A (en) | 1993-06-25 | 1999-10-05 | Yale University | Triple-helix forming oligonucleotides for targeted mutagenesis |
ES2186690T3 (en) | 1993-09-02 | 2003-05-16 | Ribozyme Pharm Inc | ENZYMATIC NUCLEIC ACID CONTAINING NON-NUCLEOTIDES. |
US5502177A (en) | 1993-09-17 | 1996-03-26 | Gilead Sciences, Inc. | Pyrimidine derivatives for labeled binding partners |
US5712146A (en) | 1993-09-20 | 1998-01-27 | The Leland Stanford Junior University | Recombinant combinatorial genetic library for the production of novel polyketides |
CN1525171A (en) | 1993-10-01 | 2004-09-01 | ŦԼ�и��ױ��Ǵ�ѧ���� | Complex combinatorial chemical libraries encoded with tags |
US5861288A (en) | 1993-10-18 | 1999-01-19 | Ribozyme Pharmaceuticals, Inc. | Catalytic DNA |
US5616466A (en) | 1993-11-05 | 1997-04-01 | Cantor; Glenn H. | Ribozyme-mediated inhibition of bovine leukemia virus |
US5578716A (en) | 1993-12-01 | 1996-11-26 | Mcgill University | DNA methyltransferase antisense oligonucleotides |
US5457187A (en) | 1993-12-08 | 1995-10-10 | Board Of Regents University Of Nebraska | Oligonucleotides containing 5-fluorouracil |
US5446137B1 (en) | 1993-12-09 | 1998-10-06 | Behringwerke Ag | Oligonucleotides containing 4'-substituted nucleotides |
US5712384A (en) | 1994-01-05 | 1998-01-27 | Gene Shears Pty Ltd. | Ribozymes targeting retroviral packaging sequence expression constructs and recombinant retroviruses containing such constructs |
US5641754A (en) | 1994-01-10 | 1997-06-24 | The Board Of Regents Of The University Of Nebraska | Antisense oligonucleotide compositions for selectively killing cancer cells |
US5519134A (en) | 1994-01-11 | 1996-05-21 | Isis Pharmaceuticals, Inc. | Pyrrolidine-containing monomers and oligomers |
DE69515702T2 (en) | 1994-01-20 | 2000-08-10 | British Biotech Pharm | L-tertiary leucine-2-pyridylamide |
US5683899A (en) | 1994-02-03 | 1997-11-04 | University Of Hawaii | Methods and compositions for combinatorial-based discovery of new multimeric molecules |
US5639647A (en) | 1994-03-29 | 1997-06-17 | Ribozyme Pharmaceuticals, Inc. | 2'-deoxy-2'alkylnucleotide containing nucleic acid |
US5631359A (en) | 1994-10-11 | 1997-05-20 | Ribozyme Pharmaceuticals, Inc. | Hairpin ribozymes |
US5539083A (en) | 1994-02-23 | 1996-07-23 | Isis Pharmaceuticals, Inc. | Peptide nucleic acid combinatorial libraries and improved methods of synthesis |
US5869248A (en) | 1994-03-07 | 1999-02-09 | Yale University | Targeted cleavage of RNA using ribonuclease P targeting and cleavage sequences |
AU690656B2 (en) | 1994-03-11 | 1998-04-30 | Pharmacopeia Drug Discovery, Inc. | Sulfonamide derivatives and their use |
US5596091A (en) | 1994-03-18 | 1997-01-21 | The Regents Of The University Of California | Antisense oligonucleotides comprising 5-aminoalkyl pyrimidine nucleotides |
ES2151057T3 (en) | 1994-03-23 | 2000-12-16 | Penn State Res Found | PROCEDURE FOR THE IDENTIFICATION OF ELEMENTS OF COMBINATORY LIBRARIES. |
US5627053A (en) | 1994-03-29 | 1997-05-06 | Ribozyme Pharmaceuticals, Inc. | 2'deoxy-2'-alkylnucleotide containing nucleic acid |
US5625050A (en) | 1994-03-31 | 1997-04-29 | Amgen Inc. | Modified oligonucleotides and intermediates useful in nucleic acid therapeutics |
WO1995027072A1 (en) | 1994-04-05 | 1995-10-12 | Pharmagenics, Inc. | Determination and identification of active compounds in a compound library |
US6017768A (en) | 1994-05-06 | 2000-01-25 | Pharmacopeia, Inc. | Combinatorial dihydrobenzopyran library |
US5688997A (en) | 1994-05-06 | 1997-11-18 | Pharmacopeia, Inc. | Process for preparing intermediates for a combinatorial dihydrobenzopyran library |
US5595873A (en) | 1994-05-13 | 1997-01-21 | The Scripps Research Institute | T. thermophila group I introns that cleave amide bonds |
US5683902A (en) | 1994-05-13 | 1997-11-04 | Northern Illinois University | Human papilloma virus inhibition by a hairpin ribozyme |
US5580967A (en) | 1994-05-13 | 1996-12-03 | The Scripps Research Institute | Optimized catalytic DNA-cleaving ribozymes |
US5525711A (en) | 1994-05-18 | 1996-06-11 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Pteridine nucleotide analogs as fluorescent DNA probes |
US5650316A (en) | 1994-06-06 | 1997-07-22 | Research Development Foundation | Uses of triplex forming oligonucleotides for the treatment of human diseases |
US5663046A (en) | 1994-06-22 | 1997-09-02 | Pharmacopeia, Inc. | Synthesis of combinatorial libraries |
US5998193A (en) | 1994-06-24 | 1999-12-07 | Gene Shears Pty., Ltd. | Ribozymes with optimized hybridizing arms, stems, and loops, tRNA embedded ribozymes and compositions thereof |
US5633133A (en) | 1994-07-14 | 1997-05-27 | Long; David M. | Ligation with hammerhead ribozymes |
US5597696A (en) | 1994-07-18 | 1997-01-28 | Becton Dickinson And Company | Covalent cyanine dye oligonucleotide conjugates |
US5939268A (en) | 1994-07-26 | 1999-08-17 | The Scripps Research Institute | Combinatorial libraries of molecules and methods for producing same |
JPH10503934A (en) | 1994-08-09 | 1998-04-14 | ノバルティス アクチエンゲゼルシャフト | Antitumor antisense oligonucleotide |
US5580731A (en) | 1994-08-25 | 1996-12-03 | Chiron Corporation | N-4 modified pyrimidine deoxynucleotides and oligonucleotide probes synthesized therewith |
US5597909A (en) | 1994-08-25 | 1997-01-28 | Chiron Corporation | Polynucleotide reagents containing modified deoxyribose moieties, and associated methods of synthesis and use |
US5688670A (en) | 1994-09-01 | 1997-11-18 | The General Hospital Corporation | Self-modifying RNA molecules and methods of making |
US5989908A (en) | 1994-09-12 | 1999-11-23 | City Of Hope | Modulation of drug and radiation resistant genes |
US5599706A (en) | 1994-09-23 | 1997-02-04 | Stinchcomb; Dan T. | Ribozymes targeted to apo(a) mRNA |
US5856103A (en) | 1994-10-07 | 1999-01-05 | Board Of Regents The University Of Texas | Method for selectively ranking sequences for antisense targeting |
JPH08113591A (en) | 1994-10-14 | 1996-05-07 | Taiho Yakuhin Kogyo Kk | Oligonucleotide and carcinostatic agent containing the same as active ingredient |
US6045671A (en) | 1994-10-18 | 2000-04-04 | Symyx Technologies, Inc. | Systems and methods for the combinatorial synthesis of novel materials |
US5985356A (en) | 1994-10-18 | 1999-11-16 | The Regents Of The University Of California | Combinatorial synthesis of novel materials |
US6004617A (en) | 1994-10-18 | 1999-12-21 | The Regents Of The University Of California | Combinatorial synthesis of novel materials |
US6030917A (en) | 1996-07-23 | 2000-02-29 | Symyx Technologies, Inc. | Combinatorial synthesis and analysis of organometallic compounds and catalysts |
US5603351A (en) | 1995-06-07 | 1997-02-18 | David Sarnoff Research Center, Inc. | Method and system for inhibiting cross-contamination in fluids of combinatorial chemistry device |
US5619680A (en) | 1994-11-25 | 1997-04-08 | Berkovich; Semyon | Methods and apparatus for concurrent execution of serial computing instructions using combinatorial architecture for program partitioning |
US5807718A (en) | 1994-12-02 | 1998-09-15 | The Scripps Research Institute | Enzymatic DNA molecules |
US5688696A (en) | 1994-12-12 | 1997-11-18 | Selectide Corporation | Combinatorial libraries having a predetermined frequency of each species of test compound |
US5683873A (en) | 1995-01-13 | 1997-11-04 | Innovir Laboratories, Inc. | EGS-mediated inactivation of target RNA |
US5631146A (en) | 1995-01-19 | 1997-05-20 | The General Hospital Corporation | DNA aptamers and catalysts that bind adenosine or adenosine-5'-phosphates and methods for isolation thereof |
US5627210A (en) | 1995-02-06 | 1997-05-06 | Chiron Corporation | Branched combinatorial libraries |
US5994320A (en) | 1995-02-06 | 1999-11-30 | Regents Of The University Of Minnesota | Antisense oligonucleotides and methods for treating central nervous system tumors |
US5958702A (en) | 1995-02-06 | 1999-09-28 | Benner; Steven Albert | Receptor-assisted combinatorial chemistry |
IT1275862B1 (en) | 1995-03-03 | 1997-10-24 | Consiglio Nazionale Ricerche | ANTI-SENSE TRANSCRIPT ASSOCIATED WITH SOME TYPES OF TUMOR CELLS AND SYNTHETIC OLIGODEOXYNUCLEOTIDES USEFUL IN DIAGNOSIS AND TREATMENT |
US5770715A (en) | 1995-03-22 | 1998-06-23 | Toagosei Co., Ltd. | Hammerhead-like nucleic acid analogues and their synthesis |
US6013443A (en) | 1995-05-03 | 2000-01-11 | Nexstar Pharmaceuticals, Inc. | Systematic evolution of ligands by exponential enrichment: tissue SELEX |
US5702892A (en) | 1995-05-09 | 1997-12-30 | The United States Of America As Represented By The Department Of Health And Human Services | Phage-display of immunoglobulin heavy chain libraries |
US5834318A (en) | 1995-05-10 | 1998-11-10 | Bayer Corporation | Screening of combinatorial peptide libraries for selection of peptide ligand useful in affinity purification of target proteins |
US5807754A (en) | 1995-05-11 | 1998-09-15 | Arqule, Inc. | Combinatorial synthesis and high-throughput screening of a Rev-inhibiting arylidenediamide array |
US5646031A (en) | 1995-05-16 | 1997-07-08 | Northern Illinois University | SArMV and sCYMVI hairpin ribozymes |
US5693773A (en) | 1995-06-07 | 1997-12-02 | Hybridon Incorporated | Triplex-forming antisense oligonucleotides having abasic linkers targeting nucleic acids comprising mixed sequences of purines and pyrimidines |
US6040296A (en) | 1995-06-07 | 2000-03-21 | East Carolina University | Specific antisense oligonucleotide composition & method for treatment of disorders associated with bronchoconstriction and lung inflammation |
US5910408A (en) | 1995-06-07 | 1999-06-08 | The General Hospital Corporation | Catalytic DNA having ligase activity |
PT833944E (en) | 1995-06-07 | 2009-04-14 | Gilead Sciences Inc | Nucleic acid ligands that bind to and inhibit dna polymerases |
US5646285A (en) | 1995-06-07 | 1997-07-08 | Zymogenetics, Inc. | Combinatorial non-peptide libraries |
CA2223109A1 (en) * | 1995-06-07 | 1996-12-19 | Yathi M. Naidu | Use of antisense oligonucleotides to il-6 receptor mrna to inhibit cellular proliferation |
US5891737A (en) | 1995-06-07 | 1999-04-06 | Zymogenetics, Inc. | Combinatorial non-peptide libraries |
US5958792A (en) | 1995-06-07 | 1999-09-28 | Chiron Corporation | Combinatorial libraries of substrate-bound cyclic organic compounds |
EP0839152B1 (en) | 1995-06-21 | 2002-03-13 | Martek Biosciences Corporation | Combinatorial libraries of labeled biochemical compounds and methods for producing same |
US5962337A (en) | 1995-06-29 | 1999-10-05 | Pharmacopeia, Inc. | Combinatorial 1,4-benzodiazepin-2,5-dione library |
US5877021A (en) | 1995-07-07 | 1999-03-02 | Ribozyme Pharmaceuticals, Inc. | B7-1 targeted ribozymes |
US5834588A (en) | 1995-07-14 | 1998-11-10 | Yale University | (Cyanomethylene) phosphoranes as carbonyl 1,1-dipole synthons for use in constructing combinatorial libraries |
NO953680D0 (en) | 1995-09-18 | 1995-09-18 | Hans Prydz | Cell cycle Enzymes |
AU7286696A (en) | 1995-10-13 | 1997-05-07 | F. Hoffmann-La Roche Ag | Antisense oligomers |
US5874443A (en) | 1995-10-19 | 1999-02-23 | Trega Biosciences, Inc. | Isoquinoline derivatives and isoquinoline combinatorial libraries |
WO1997018312A1 (en) | 1995-11-14 | 1997-05-22 | Vimrx Holdings, Ltd. | Chimeric oligomers having an rna-cleavage activity |
PL326674A1 (en) | 1995-11-21 | 1998-10-12 | Icn Pharmaceuticals | Inhibition of tumor growth by means of oligonucleotides being antisensual for the il-8 and il-8 receptor |
US5998203A (en) | 1996-04-16 | 1999-12-07 | Ribozyme Pharmaceuticals, Inc. | Enzymatic nucleic acids containing 5'-and/or 3'-cap structures |
US6031071A (en) | 1996-01-24 | 2000-02-29 | Biophage, Inc. | Methods of generating novel peptides |
CA2246503A1 (en) | 1996-02-15 | 1997-08-21 | National Institutes Of Health | Rnase l activators and antisense oligonucleotides effective to treat rsv infections |
US5880972A (en) | 1996-02-26 | 1999-03-09 | Pharmacopeia, Inc. | Method and apparatus for generating and representing combinatorial chemistry libraries |
US5877162A (en) | 1996-03-14 | 1999-03-02 | Innovir Laboratories, Inc. | Short external guide sequences |
US5847150A (en) | 1996-04-24 | 1998-12-08 | Novo Nordisk A/S | Solid phase and combinatorial synthesis of substituted 2-methylene-2, 3-dihydrothiazoles and of arrays of substituted 2-methylene-2, 3-dihydrothiazoles |
GB9610811D0 (en) | 1996-05-23 | 1996-07-31 | Pharmacia Spa | Combinatorial solid phase synthesis of a library of indole derivatives |
GB9610813D0 (en) | 1996-05-23 | 1996-07-31 | Pharmacia Spa | Combinatorial solid phase synthesis of a library of benzufuran derivatives |
US5792431A (en) | 1996-05-30 | 1998-08-11 | Smithkline Beecham Corporation | Multi-reactor synthesizer and method for combinatorial chemistry |
US5792613A (en) | 1996-06-12 | 1998-08-11 | The Curators Of The University Of Missouri | Method for obtaining RNA aptamers based on shape selection |
US5840500A (en) | 1996-07-11 | 1998-11-24 | Trega Biosciences, Inc. | Quinoline derivatives and quinoline combinatorial libraries |
US5955590A (en) | 1996-07-15 | 1999-09-21 | Worcester Foundation For Biomedical Research | Conjugates of minor groove DNA binders with antisense oligonucleotides |
DE19631178C1 (en) | 1996-08-02 | 1997-08-21 | Siemens Ag | Inspecting corrosion of carbon steel |
AU741663B2 (en) * | 1996-08-22 | 2001-12-06 | Magainin Pharmaceuticals, Inc. | Compositions and methods for use of defensin |
WO1998008839A1 (en) | 1996-08-26 | 1998-03-05 | Eli Lilly And Company | Combinatorial process for preparing substituted thiophene libraries |
US5886127A (en) | 1996-08-28 | 1999-03-23 | University Of South Florida | Combinatorial method of forming cascade polymer surfaces |
US5886126A (en) | 1996-08-28 | 1999-03-23 | University Of South Florida | Combinatorial method of forming cascade polymer surfaces |
US5877214A (en) | 1996-09-12 | 1999-03-02 | Merck & Co., Inc. | Polyaryl-poly(ethylene glycol) supports for solution-phase combinatorial synthesis |
DE19639937C1 (en) | 1996-09-27 | 1998-03-12 | Siemens Ag | Circuit arrangement with combinatorial blocks arranged between registers |
US5916899A (en) | 1996-10-18 | 1999-06-29 | Trega Biosciences, Inc. | Isoquinoline derivatives and isoquinoline combinatorial libraries |
US6051698A (en) | 1997-06-06 | 2000-04-18 | Janjic; Nebojsa | Vascular endothelial growth factor (VEGF) nucleic acid ligand complexes |
US5874566A (en) | 1996-10-25 | 1999-02-23 | Hisamitsu Pharmaceutical Co. Inc. | Il-15 triplex oligonucleotides |
US6025371A (en) | 1996-10-28 | 2000-02-15 | Versicor, Inc. | Solid phase and combinatorial library syntheses of fused 2,4-pyrimidinediones |
US5945070A (en) | 1996-10-31 | 1999-08-31 | Merck & Co., Inc. | Reaction vessel filter for combinatorial chemistry or biological use |
US5972719A (en) | 1996-11-05 | 1999-10-26 | Pharmacopeia, Inc. | Combinatorial hydroxy-amino acid amide libraries |
US5965719A (en) | 1996-11-15 | 1999-10-12 | Sunsorb Biotech, Inc. | Combinatorial synthesis of carbohydrate libraries |
US5925527A (en) | 1997-02-04 | 1999-07-20 | Trega Biosciences, Inc. | Tricyclic Tetrahydroquinoline derivatives and tricyclic tetrahydroquinoline combinatorial libraries |
US5856107A (en) | 1997-02-04 | 1999-01-05 | Trega Biosciences, Inc. | Combinatorial libraries of imidazol-pyrido-indole and imidazol-pyrido-benzothiophene derivatives, methods of making the libraries and compounds therein |
US5859190A (en) | 1997-02-04 | 1999-01-12 | Trega Biosciences, Inc. | Combinatorial libraries of hydantoin and thiohydantoin derivatives, methods of making the libraries and compounds therein |
US6046004A (en) | 1997-02-27 | 2000-04-04 | Lorne Park Research, Inc. | Solution hybridization of nucleic acids with antisense probes having modified backbones |
US6045755A (en) | 1997-03-10 | 2000-04-04 | Trega Biosciences,, Inc. | Apparatus and method for combinatorial chemistry synthesis |
US5976894A (en) | 1997-04-14 | 1999-11-02 | Pharmacopeia, Inc. | Combinatorial amide alcohol libraries |
US5948696A (en) | 1997-06-16 | 1999-09-07 | Pharmacopeia, Inc. | Combinatorial biaryl amino acid amide libraries |
US6300483B1 (en) | 1997-06-19 | 2001-10-09 | Ribozyme Pharmaceuticals, Inc. | Compositions inducing cleavage of RNA motifs |
CA2295207A1 (en) | 1997-06-19 | 1998-12-23 | Innovir Laboratories, Inc. | Hammerhead ribozymes with extended cleavage rule |
JPH1142091A (en) | 1997-07-25 | 1999-02-16 | Toagosei Co Ltd | Anti-sense nucleic acid compound |
US6046319A (en) | 1997-10-22 | 2000-04-04 | University Technologies International, Inc. | Antisense oligodeoxynucleotides regulating expression of TNF-α |
US6008321A (en) | 1998-03-16 | 1999-12-28 | Pharmacopeia, Inc. | Universal linker for combinatorial synthesis |
CA2330929A1 (en) | 1998-06-06 | 1999-12-16 | Genostic Pharma Limited | Probes used for genetic profiling |
US6007995A (en) | 1998-06-26 | 1999-12-28 | Isis Pharmaceuticals Inc. | Antisense inhibition of TNFR1 expression |
US6699973B1 (en) | 1998-11-19 | 2004-03-02 | Elan Corporation, Plc | Antibodies to peptides that target GIT receptors and related methods |
GB9903841D0 (en) * | 1999-02-20 | 1999-04-14 | Imp College Innovations Ltd | Diagnosis and treatment of cancer |
US6013522A (en) | 1999-02-23 | 2000-01-11 | Isis Pharmaceuticals Inc. | Antisense inhibition of human Smad1 expression |
US6025198A (en) | 1999-06-25 | 2000-02-15 | Isis Pharmaceuticals Inc. | Antisense modulation of Ship-2 expression |
US6033910A (en) | 1999-07-19 | 2000-03-07 | Isis Pharmaceuticals Inc. | Antisense inhibition of MAP kinase kinase 6 expression |
AU2139001A (en) * | 1999-12-22 | 2001-07-03 | Mcgill University | Modulation of PAX-2 for controlled apoptosis or survival of cells |
US20030092657A1 (en) * | 1999-12-22 | 2003-05-15 | Paul Goodyer | Modulation of PAX-2 for controlled apoptosis or survival of cells |
US20070026394A1 (en) * | 2000-02-11 | 2007-02-01 | Lawrence Blatt | Modulation of gene expression associated with inflammation proliferation and neurite outgrowth using nucleic acid based technologies |
WO2002022686A2 (en) | 2000-09-15 | 2002-03-21 | The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services, National Institutes Of Health, Office Of Technology Transfer | Defensin-antigen fusion proteins |
US20030170891A1 (en) * | 2001-06-06 | 2003-09-11 | Mcswiggen James A. | RNA interference mediated inhibition of epidermal growth factor receptor gene expression using short interfering nucleic acid (siNA) |
US7294504B1 (en) * | 2001-12-27 | 2007-11-13 | Allele Biotechnology & Pharmaceuticals, Inc. | Methods and compositions for DNA mediated gene silencing |
ATE416183T1 (en) * | 2002-02-01 | 2008-12-15 | Univ Mcgill | OLIGONUCLEOTIDES WITH ALTERNATE SEGMENTS AND USES THEREOF |
US20040142393A1 (en) * | 2002-08-01 | 2004-07-22 | Cooper Garth James Smith | Methods of use of compounds with preptin function |
WO2004041185A2 (en) | 2002-10-31 | 2004-05-21 | University Of Rochester | Hyfroxyflutamide induced pathways related to androgen receptor negative prostate cancer cells |
EP2314691A3 (en) * | 2002-11-14 | 2012-01-18 | Dharmacon, Inc. | Fuctional and hyperfunctional siRNA |
US20060135422A1 (en) | 2003-04-17 | 2006-06-22 | Moskowitz David W | Use of angiotensin receptor blockers (ARBs) to treat diseases associated with excess ACE |
US8673634B2 (en) | 2003-11-13 | 2014-03-18 | Massachusetts Eye & Ear Infirmary | Method for the treatment of hearing loss |
NZ551934A (en) * | 2004-06-24 | 2009-09-25 | Inst Medical W & E Hall | Conjugates comprising a targeting moiety and a peptide that mimics the apoptosis-inducing BH3-only proteins |
US20060078535A1 (en) * | 2004-10-13 | 2006-04-13 | The Regents Of The University Of Michigan | Anticancer compounds and methods |
CN101511179A (en) | 2005-02-25 | 2009-08-19 | 密执安州立大学董事会 | Small molecule inhibitors of STAT3 and the uses thereof |
US20070166728A1 (en) | 2005-07-22 | 2007-07-19 | Alphagenics, Inc. | Genetic profile imaging and data-sharing device and methodology for socially relevant traits |
-
2006
- 2006-10-16 EP EP11160842A patent/EP2392645A1/en not_active Withdrawn
- 2006-10-16 EP EP11160888A patent/EP2402435A3/en not_active Withdrawn
- 2006-10-16 EP EP11160862A patent/EP2395076A1/en not_active Withdrawn
- 2006-10-16 EP EP06816925A patent/EP1934331A4/en not_active Withdrawn
- 2006-10-16 WO PCT/US2006/040215 patent/WO2007047512A2/en active Application Filing
- 2006-10-16 EP EP09178274A patent/EP2189522A1/en not_active Ceased
- 2006-10-16 US US12/090,191 patent/US7964577B2/en active Active
- 2006-10-16 EP EP11160868A patent/EP2392647A1/en not_active Withdrawn
- 2006-10-16 CA CA002625891A patent/CA2625891A1/en not_active Abandoned
- 2006-10-16 EP EP11160864A patent/EP2392646A1/en not_active Withdrawn
- 2006-10-16 AU AU2006304321A patent/AU2006304321B2/en not_active Ceased
-
2011
- 2011-01-13 US US13/005,579 patent/US8735365B2/en active Active
- 2011-01-13 US US13/005,568 patent/US8318692B2/en active Active
- 2011-01-19 US US13/009,594 patent/US20110177075A1/en not_active Abandoned
- 2011-01-20 US US13/009,970 patent/US20110177101A1/en not_active Abandoned
- 2011-01-21 US US13/010,867 patent/US8431546B2/en active Active
Also Published As
Publication number | Publication date |
---|---|
US20110177100A1 (en) | 2011-07-21 |
US8431546B2 (en) | 2013-04-30 |
EP2392646A1 (en) | 2011-12-07 |
US8735365B2 (en) | 2014-05-27 |
WO2007047512A2 (en) | 2007-04-26 |
US20110236403A1 (en) | 2011-09-29 |
US7964577B2 (en) | 2011-06-21 |
EP2395076A1 (en) | 2011-12-14 |
EP2402435A3 (en) | 2012-03-28 |
US20110177101A1 (en) | 2011-07-21 |
EP1934331A2 (en) | 2008-06-25 |
US20100196450A1 (en) | 2010-08-05 |
EP2392647A1 (en) | 2011-12-07 |
AU2006304321A1 (en) | 2007-04-26 |
WO2007047512A3 (en) | 2007-06-14 |
EP2189522A1 (en) | 2010-05-26 |
US8318692B2 (en) | 2012-11-27 |
EP1934331A4 (en) | 2009-01-21 |
AU2006304321A2 (en) | 2008-11-13 |
US20110178162A1 (en) | 2011-07-21 |
US20110177075A1 (en) | 2011-07-21 |
EP2392645A1 (en) | 2011-12-07 |
EP2402435A2 (en) | 2012-01-04 |
AU2006304321B2 (en) | 2012-10-04 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US8431546B2 (en) | Targeting PAX2 for the induction of DEFB1-mediated tumor immunity and cancer therapy | |
KR101565080B1 (en) | Compositions and methods for diagnosing treating and preventing prostate conditions | |
JP6128732B2 (en) | Treatment of apolipoprotein-A1 related diseases by suppression of natural antisense transcripts against apolipoprotein-A1 | |
JP4658936B2 (en) | Compositions and methods for treating lung cancer | |
AU2009351638B2 (en) | Detecting PAX2 for the diagnosis of breast cancer | |
US20220259596A1 (en) | Inhibitors of microRNA 451a for Treatment of Endometriosis | |
WO2006037127A2 (en) | Single-stranded antimicrobial oligonucleotides and uses thereof | |
Schultheiß | Elucidation of the cell-specific regulation of the novel human tumor gene NOT |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
EEER | Examination request | ||
FZDE | Discontinued |
Effective date: 20141016 |